KEGG   Pseudorhodobacter sp. S12M18: EOK75_17410Help
Entry
EOK75_17410       CDS       T05954                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K23063  hydroxyproline transport system permease protein
Organism
pseb  Pseudorhodobacter sp. S12M18
Pathway
pseb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pseb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EOK75_17410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pseb02000]
    EOK75_17410
Transporters [BR:pseb02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Hydroxyproline transporter
    EOK75_17410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: QCO57490
LinkDB All DBs
Position
unnamed1:1026745..1027398
Genome map
AA seq 217 aa AA seqDB search
MFETSLTLSDLMFLAKGAGMTIAVTFFAVTGGTLMGLLFGVIRAQISPWAALPLTFVLDI
FRSVPLLIQLVLANAFQAIAGLNLPPFATSCIILALYTSAYCTEIVRGAIDAVPMVTRRA
ARSLGLSWGQDMTYVVFPMALRVALPSWIGLTLGVLKDSALVLWLGLIELLRSGQILVTR
LQEPMFILLVVGLIYFLLSFPIARFGSQLEKRWREND
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaacctcattgacgctaagcgaccttatgttcctggccaaaggcgcggggatg
acgattgccgtcacctttttcgcggtgacgggcggtacattgatgggcctgctgttcggc
gttatccgtgcacaaatcagcccttgggcggcgctgccgctgacgtttgtgctggatatc
ttccgctcggtcccgctgctgatccaacttgtgctggccaatgcatttcaggcgattgcg
gggctgaacctgccgcctttcgccacgtcctgcattattctggcgctttatacctcggcc
tattgcaccgagattgtgcgcggcgcgattgatgcggtgccgatggtgacacgccgcgcg
gcacgatcattgggcctaagctgggggcaggatatgacttatgtcgtgttcccgatggcc
cttcgtgtggccttgccaagctggatcggcctgacattgggcgtgctgaaagacagcgcg
ctggtgctgtggctggggctgatcgaactgctccgctcgggccagatccttgtgacccgc
ctgcaagagccgatgttcatcctgcttgtcgtaggtctgatttacttcctgctaagcttc
cccattgcccgctttggcagccaactcgaaaaaaggtggcgcgagaatgattga

DBGET integrated database retrieval system