KEGG   Pseudomonas sp. CCOS 191: CCOS191_0597Help
Entry
CCOS191_0597      CDS       T03967                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00340  Histidine metabolism
psec01100  Metabolic pathways
psec01110  Biosynthesis of secondary metabolites
psec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CCOS191_0597 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: CRI55133
UniProt: A0A0F7Y0E0
LinkDB All DBs
Position
I:642611..643798
Genome map
AA seq 395 aa AA seqDB search
MATVDRWLLPDGIEEVLPPEAARIEIARRQVLDLFQSWGYELVVTPHIEYLESLLTGAGQ
DLDQRTFKVVDPQSGRLMGFRADFTPQVARIDAHTLRREGPSRLCYAGSVLHAQPRALST
SRSPIQLGAELYGDASPTSDVEVISLMLATLQLTDVADVHMDLGHVGIYRGLARAANLSG
AVEQQLFDALQRKAVDEVQALTADLSKDLGNMLRALCELCGGREVLAEARVRLGRAPASV
LAALDDLLAIADRLASRYPDLPLYFDLGELRGYHYHTGVVFAVFVPGEGQSIAQGGRYDD
IGADFGRARPATGFSTDLKTLVTLGRAEVVLPAGGIWMPDSSDAALWQMVCQLRNEGQRV
VQALPGQPLSAALEADCDRQLIQQDGRWQVLPLTH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtagaccgctggctactgccagatggcatcgaggaagtactgccacctgag
gcggcgcgcatcgagatcgcgcgtcgtcaggtgttggacctgttccagagttggggttac
gaactggtcgtcaccccgcatatcgagtacctggagtcgctgctcaccggcgccggccag
gacctggaccagcgtaccttcaaggtcgtcgacccgcagtccggccgcctgatgggcttc
cgtgccgacttcacgccgcaggtggcgcgcatcgacgcccacaccctgcgccgtgaaggc
ccgagccgcctgtgctatgccggcagcgtgctgcatgcgcagccgcgtgccctgtcgacc
tcgcgcagcccgatccagctgggcgccgagctgtacggcgacgccagccctaccagcgat
gtcgaagtcatcagcctgatgctcgccacgctgcaactgaccgatgtcgccgatgtgcac
atggaccttggccatgtcggtatctatcgcggtctggcccgtgccgccaacctgtccggc
gcggtcgagcagcaactgttcgatgcccttcagcgcaaggccgtcgatgaagtgcaggcg
ctgaccgcagacctgtcgaaggacctgggcaacatgttgcgtgccctgtgcgagctgtgc
ggtggtcgtgaagtgctggccgaggcgcgtgtgcgcctcggccgcgccccggccagcgtg
ctggcggcgctggacgacctgttggcgatcgccgatcgcctggcttcgcgctacccggac
ctgccgctgtacttcgacctcggcgaactgcgcggctaccactatcacaccggcgtggtg
ttcgccgtgttcgtgcctggcgaaggtcaatcgatcgcccagggcggccgctatgacgac
atcggcgctgattttggccgggcacgcccggccaccggattctccacggatttgaagacc
ctggtcacactggggcgagcggaggtcgtattgcctgctggcggcatctggatgcccgac
agcagcgatgcggccctctggcagatggtctgccagttgcgcaacgagggccagcgagtg
gtccaggctttgcctggccagccgctgagtgctgccctcgaggcggattgtgatcggcaa
ttgattcagcaagacgggcgctggcaggttctgccgctgacccattga

DBGET integrated database retrieval system