KEGG   Pseudomonas sp. CCOS 191: CCOS191_0686Help
Entry
CCOS191_0686      CDS       T03967                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00790  Folate biosynthesis
psec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCOS191_0686 (folP)
Enzymes [BR:psec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CCOS191_0686 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CRI55222
UniProt: A0A0F7Y320
LinkDB All DBs
Position
I:742313..743164
Genome map
AA seq 283 aa AA seqDB search
MSSKQYPTRLPCGNRVLDLSRTHVMGILNITPDSFSDGGRFNQRDEALRHAEEMVAAGAT
LIDVGGESTRPGARAVSPTEELERVAPIVEAINSRLDVVISVDTSTPAVMRESARLGAGL
INDVRALERDGALDAAADTGLPVCLMHMRGEPGTMQDNPQYEDVTADVTRYLEQRMAACA
AAGIGAERIILDPGFGFAKTLEHNLSLFKHMEALYRLGRPLLVGVSRKSMIGLALGRPVG
ERLYGSLALAALAMTKGASILRVHDVAETVDVVRMIAAVQSAE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaagcagtacccgacccggttgccttgcggcaaccgggttcttgatttgtcc
cgtacccatgtcatgggtatcctcaacatcaccccagactcgttctccgatggtgggcgc
ttcaatcagcgcgacgaggccctgcgtcatgccgaggagatggtggcggccggagcgacc
ctgatcgatgtggggggcgagtccacccgtccgggtgcccgcgccgtttcgcctaccgag
gagctagaacgcgtggcaccgattgtcgaggcgatcaacagccggctcgacgtggtcatc
tcggtcgatacctcgacgcctgcggtcatgcgcgaatccgcgcgcctcggcgctggcttg
atcaacgacgtgcgcgccctggagcgcgacggtgcgcttgatgcggcggcggacaccggc
ttaccggtgtgtctcatgcacatgcgcggcgagccgggcaccatgcaggacaatccgcag
tacgaagatgtgacagccgatgttacgcgctatcttgaacagcgtatggccgcctgcgcg
gcggcaggcatcggggctgagcgcatcatcctcgacccggggttcggctttgccaagacc
ctcgagcacaatctcagccttttcaaacacatggaagcgctctatcgcctcggcaggccg
ctcctggtaggcgtctcgcgcaagagcatgatcggcctcgcgctgggccgccccgtcggt
gagcgcctgtacggtagcctggcgctggcggcattggccatgaccaagggtgcgagcatc
ctgcgggtgcatgacgtggcggaaaccgtcgacgtggtgcgcatgatcgcggccgtgcag
agcgccgaataa

DBGET integrated database retrieval system