KEGG   Pseudomonas sp. CCOS 191: CCOS191_0992Help
Entry
CCOS191_0992      CDS       T03967                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec03030  DNA replication
psec03430  Mismatch repair
psec03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CCOS191_0992 (holC)
   03430 Mismatch repair
    CCOS191_0992 (holC)
   03440 Homologous recombination
    CCOS191_0992 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psec03032]
    CCOS191_0992 (holC)
   03400 DNA repair and recombination proteins [BR:psec03400]
    CCOS191_0992 (holC)
Enzymes [BR:psec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CCOS191_0992 (holC)
DNA replication proteins [BR:psec03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CCOS191_0992 (holC)
DNA repair and recombination proteins [BR:psec03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CCOS191_0992 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CRI55528
UniProt: A0A0F7Y1J3
LinkDB All DBs
Position
I:complement(1088760..1089188)
Genome map
AA seq 142 aa AA seqDB search
MSKVDFYILPSDSLSVRLDFACKLCEKAWRLGHRVYLHCQDEAQRSELDLRLWQFKGEAF
LPHDHAEQHPDAVVALGVGADAGQHRDLLINLGGEVPAFVGQFERVAEIVVEEPAIRLAA
RERFRFYREQGYALQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcgatttctacatcctgcccagcgactcgctgtcggtgcgcctggatttc
gcctgcaagctgtgcgaaaaggcctggcgcctcggccaccgggtctacctgcactgccag
gacgaggcgcagcgcagcgagctcgacctgcgcctgtggcagttcaagggcgaggccttc
ttgccccacgaccatgccgaacagcatccggacgccgttgtcgcgctgggtgtcggcgcc
gatgctggccaacaccgtgacctgctgatcaacctgggtggcgaggttccggcctttgtc
ggccagttcgaacgggtcgccgaaatcgtcgtcgaggaaccggccatccgcctggccgct
cgcgagcgattccgtttctaccgcgaacagggctatgctctgcaagaccaccgcttacag
cgactctga

DBGET integrated database retrieval system