KEGG   Pseudomonas sp. CCOS 191: CCOS191_1127Help
Entry
CCOS191_1127      CDS       T03967                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00061  Fatty acid biosynthesis
psec00780  Biotin metabolism
psec01100  Metabolic pathways
psec01212  Fatty acid metabolism
Module
psec_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCOS191_1127 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CCOS191_1127 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psec01004]
    CCOS191_1127 (fabZ)
Enzymes [BR:psec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CCOS191_1127 (fabZ)
Lipid biosynthesis proteins [BR:psec01004]
 Fatty acid synthase
  Component type
   CCOS191_1127 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: CRI55663
UniProt: A0A0F7Y1W6
LinkDB All DBs
Position
I:1250872..1251312
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVTDLDFEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRKSMI
WKFECRALVDGKPVCSAEITCAERSL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgctggtg
gaccgggtgacggacctggacttcgaggcccaaagcattcgtgcctacaagaatgtcagc
atcaacgagccgttcttcaatggccacttcccggcgcatccgatcatgccgggcgtgctg
atcatcgaggcgatggcccaggcggccggaattctcggattcaagatgctcgacgccaaa
ccggctgacggcacgctttactactttgtcggctccgacaagctgcgtttccgccagcca
gtgctgccgggcgaccagctggtcctggaagccaagttcctcagccgcaagagcatgatc
tggaagttcgaatgccgtgccctggtggacggcaagccagtctgctcggccgagatcacc
tgcgcggaacgctccctatga

DBGET integrated database retrieval system