KEGG   Pseudomonas sp. CCOS 191: CCOS191_1605
Entry
CCOS191_1605      CDS       T03967                                 

Gene name
rlmL
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase K/L
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
psec  Pseudomonas sp. CCOS 191
Brite
KEGG Orthology (KO) [BR:psec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psec03009]
    CCOS191_1605 (rlmL)
Enzymes [BR:psec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     CCOS191_1605 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     CCOS191_1605 (rlmL)
Ribosome biogenesis [BR:psec03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CCOS191_1605 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_11 Methyltransf_15 PrmA
Other DBs
NCBI-ProteinID: CRI56141
UniProt: A0A0F7XW37
LinkDB
Position
I:1809353..1811551
AA seq 732 aa
MSDRFELYLTCPKGLEGLLAEEARQLGLSEVREHTSAIRGDADMETAYRLCLWSRLANRV
LLVLKRFSMKNADDLYDGVHALDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKVDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRSGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFTAWLGHVP
ALWRKLHDEAQARAQVGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVAS
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWDAAVFTGAPELGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGDRRQAQPEAGENEPRRQAPVASEPAR
LSEGAQMFANRLQKNFKQLGKWARREKVDCYRVYDADMPEYALAVDLYHDWVHVQEYAAP
RSIDPDKAQARLLDALSAIPQALGVDPQRVVLKRRERQTGTRQYERQATEGRFQEVSEGG
VKLLVNLTDYLDTGLFLDHRPMRLRIQREAAGKRFLNLFCYTATASVHAAKGGARSTTSV
DLSKTYLDWARRNLSLNGFSERNRLEQGDVMAWLENAQDSYDLIFIDPPTFSNSKRMEGV
FDVQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLATRYAVEEISAQTLDPDFARN
NRIHRAWQLRLR
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttatctcacctgccccaagggtcttgaaggcctgctcgcc
gaggaggcccgccaattgggcctgagcgaggtgcgtgaacacacctcggccattcgcggc
gacgccgatatggaaaccgcctatcgcctgtgcctgtggtcgcgtctggccaaccgggtg
ctgctggtgctcaagcgtttttccatgaagaacgccgatgacctctatgacggtgtgcat
gccctggattgggccgatcacctggcggccgacggtacgctggcggtggagttcagcggc
catggatcgggtatcgacaacacccacttcggcgccctgaaagtgaaggacgccatcgtc
gacaagctgcgcaaccgtgaaggcctgcgcccgtcggtggagaaggtcgacccggatgtg
cgcgtacacctgcgcctggaccgtggcgaggccattctgtccctcgacctgtctggccac
agcctgcaccagcgcggctatcgcctgcagcagggcgcggcgccattgaaggaaaacctg
gcagcggcggtgctgatccgctcgggctggccacgcattgcggccgagggcggcgccctg
gctgacccgatgtgcggtgtgggcaccttcctggtcgaggcggcgatgattgccgccgat
atcgcccccaacctcaagcgcgagcgctggggcttcacggcctggctcggacatgtgccg
gcgttgtggcgcaagctgcacgacgaggcccaggcccgtgcccaggtgggcctggccaag
ccaccgctgtggattcgtggctacgaggccgacccgcggctgatccagccgggacgcaac
aacgtcgagcgcgcaggcctgggtgactgggtgaagatctaccagggcgaggtcgccagc
ttcgaaccgcgtccggaccagaaccagaagggcctggtgatcagcaacccgccctatggc
gagcgcctgggtgatgaagccagcctgctgtacctctaccagaacctcggcgagcgcctg
cgccaggcgtgcatgggctgggacgcggcggtgttcactggtgcgccggagctgggcaag
cgcatgggcatccgcagccacaagcagtacgctttctggaacggcgcattgccgtgcaag
ctgctgctgttcaaggtccagccggaccagttcgtcaccggcgatcgtcgccaggcccag
cccgaggcgggcgagaacgagccgcgccgccaggcgccggtggccagcgagccggcgcgc
ctgtcggaaggcgcgcagatgttcgccaaccgcctgcagaagaacttcaagcagctgggc
aagtgggcccgtcgcgagaaggtcgattgctaccgcgtgtacgatgccgacatgcccgag
tacgccctggctgtcgacctgtatcacgactgggtacacgtgcaggaatacgccgcgccc
cgttcgatcgatccggacaaggcccaggcgcgcctgctcgacgcgctgagcgcgattccc
caagccctgggcgtcgatccgcagcgcgtggtgctcaagcgccgggaacgccagaccggc
actcgccagtacgaacgccaggccaccgaaggacgcttccaggaagtcagcgaaggcggc
gtcaagctgctggtcaacctcaccgactacctcgacaccggcctgttcctcgaccatcgc
ccgatgcgcctgcgtatccagcgcgaggcggcgggcaagcgcttcctcaacctgttctgc
tacaccgccacggccagcgtgcacgcagccaagggcggcgcgcgcagcaccaccagcgtc
gacctgtcgaagacctacctggactgggcacggcgcaacctgtcgctcaacggtttctcc
gagcgcaaccgcctggagcagggcgacgtcatggcctggctggagaacgcccaggacagc
tacgacctgatcttcatcgacccgccgaccttctccaactccaagcgcatggaaggggtg
ttcgacgtgcagcgcgaccatgtgcagctgctcgacctggccatggcgcgcctggcgccg
ggtggtgtgctgtacttctccaacaacttccgcaagttccagctcgacgagcacctggcg
acgcggtatgcggtggaggaaatcagcgcccagaccctggatcctgacttcgctcgcaac
aaccgcatccatcgcgcctggcaactgcgtttgcgctga

DBGET integrated database retrieval system