KEGG   Pseudomonas sp. CCOS 191: CCOS191_2075Help
Entry
CCOS191_2075      CDS       T03967                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psec  Pseudomonas sp. CCOS 191
Brite
KEGG Orthology (KO) [BR:psec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCOS191_2075 (ahpF)
Enzymes [BR:psec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCOS191_2075 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Glutaredoxin FAD_binding_3 NAD_binding_7 K_oxygenase FMO-like Thi4 NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CRI56611
UniProt: A0A0F7XX76
LinkDB All DBs
Position
I:2282532..2284094
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGADTR
RPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPSVRHVAIDGALFQDEVEARKVMAVPSIYLNGEVF
GQGRMGLEEILGKIDTNAGARQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPASDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQQYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVVGDGE
KVTGLRYKDRSTEALHDLALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggcgcgaagtcccgtgaattgcacgacctgctg
gtggaaatcgccggcctgtcgaacctgattaccttcagcgcggacggcgccgacacccgt
cgcccttcgttctcgctgaaccgcccggggtctgatatcagcctgcgcttcgccggcatc
cccatgggccacgaattcacctccctggtgctggcgctgctgcaagtcggtggccatccc
tccaaggccagtgccgaagtgatcgagcagatccaggcgctggaaggcgagttcaccttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccagtgtgcgccacgtcgccatcgacggcgcgttgttccaggat
gaagtcgaagcccgcaaggtcatggccgtgccgagcatctacctgaacggcgaagtgttc
ggccagggccgcatgggtctggaagagattcttggcaagatcgacaccaatgccggcgcc
cgccaggccgagaagatcaacgccaaggacgccttcgacgtgctggtggtcggcggtggc
ccggccggtgccgccgcagcgatctacgccgcgcgcaaaggcatccgtaccggtgttgcg
gccgagcgtttcggcggccaggtgctcgacaccctggccatcgagaacttcatctcggtg
caggaaaccgaagggccgaagctggccacggcgctggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctgcagcgcggcgaagcgttgatcccggccagcgacggcggcctg
cacgaagtacgcctggccggcggcgcctcgctcaaggccaagactgtgatcctggccacc
ggtgcccgctggcgtgaaatgaacgtgccgggcgagcagcagtaccgcgctcgcggcgtg
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggt
ggcggcaactccggcgtggaagcggccatcgacctggccggcgtcgttgcccaggtgacc
ctgatcgagttcgacagccagctgcgtgccgacgccgtgttgcagcgcaagctgcacagc
ctgccgaacgtcaaggtgatcaccagcgcgctgaccaccgaagtggtcggcgacggtgaa
aaggtcaccggcctgcgctacaaggaccgcagcaccgaggcgctgcatgacctggcgctg
gaaggcatcttcgtgcagatcggcttgctgcccaataccgattggctcaagggcaccgtg
gagctgtcgccgcgcggcgagatcatcgtcgacgccaggggccagaccagcatcccgggt
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtcatcgccgtgggc
gagggcgccaaggcttcgctggccgccttcgatcacttgatccgcacttcggccccggcc
tga

DBGET integrated database retrieval system