KEGG   Pseudomonas sp. CCOS 191: CCOS191_2229Help
Entry
CCOS191_2229      CDS       T03967                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
psec  Pseudomonas sp. CCOS 191
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 Crp B-block_TFIIIC HTH_Crp_2 TrmB HTH_IclR HxlR LexA_DNA_bind FeoC DUF2250 RP-C HTH_45 Fe_dep_repress PadR
Motif
Other DBs
NCBI-ProteinID: CRI56765
UniProt: A0A0F7XWK3
LinkDB All DBs
Position
I:2485872..2486345
Genome map
AA seq 157 aa AA seqDB search
MSHFTPENFQTCAIGMLLGRAALLKDRILDWHLEADGVTAAQFKVLIIVTQYQVDTPAEL
CRYLGLDSGSMTRMLDRLEQKGLILRNRCPDDRRQVRLALTADGQRLADRLPQVGAAAMN
ELVGVLQPEELKTLEQLLAKVLLSAGDPLTIRRFGDR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatttcaccccggaaaacttccagacctgcgccatcggcatgctgctcggccgc
gccgcgctgctcaaggaccgcatcctcgactggcacctcgaagccgacggcgtcacggcc
gcccagttcaaggtgctgatcatcgtcacccagtaccaggtcgataccccggccgaactg
tgccgctacctgggcctggacagcggttcgatgacccgcatgctcgaccgcctcgagcag
aagggcctgatcctgcgcaaccgttgccccgacgaccgccgccaggtgcgcctggccctg
accgccgacggccagcgcctggccgaccgcctgccccaggtcggcgcggcggcaatgaac
gaactggtcggcgtgctgcagcccgaggagctcaagaccctcgagcaactgctcgccaaa
gtcctgctcagcgccggcgaccctctgacgatccgccgtttcggcgaccgttga

DBGET integrated database retrieval system