KEGG   Pseudomonas sp. CCOS 191: CCOS191_2525Help
Entry
CCOS191_2525      CDS       T03967                                 

Gene name
aroF2
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psec01100  Metabolic pathways
psec01110  Biosynthesis of secondary metabolites
psec01130  Biosynthesis of antibiotics
psec01230  Biosynthesis of amino acids
psec02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCOS191_2525 (aroF2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CCOS191_2525 (aroF2)
Enzymes [BR:psec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CCOS191_2525 (aroF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CRI57061
UniProt: A0A0F7XY91
LinkDB All DBs
Position
I:complement(2860343..2861404)
Genome map
AA seq 353 aa AA seqDB search
MQASNLALPLTQPHAANTTVSQRLPSPHLLKQQMPLSSELTQQVHAQRQAIRAILEGRDE
RLLVVVGPCSIHDPRSALEYADRLAALSREVDDKLLLVMRAYVEKPRTTVGWKGLAYDPH
LDGSDDMHAGIALSRGLMLGMLERGLPIATELLQPMAAGYFDDLLGWAAIGARTTESQIH
REMVSGLELPVGFKNGTDGGIGIACDAMRSAAHPHRHFGMDTQGHPAIIETLGNPDTHLV
LRGGHKGPNYDAQSVALARQGLAKAGLAPRIMVDCSHANSGKDPARQPAVFEDVLAQRLG
GDRSLVGVMLEGHLFDGCQALGKGALKYGVSITDGCLGWDATEALLCDAAARL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctcgaatctcgccctgcccctgacccagccgcacgctgccaacaccaccgtc
agccagcgcctgcccagcccgcacctgctcaaacagcagatgccgctgtccagcgaactc
acccagcaagtccatgcccagcgccaggcgatccgcgccattctcgaaggccgcgacgaa
cgcctgctggtggtggtcggcccctgctcgatccatgacccgcgctctgccctcgagtac
gccgaccgcctggccgcgctcagccgcgaggtcgacgacaagctgctgctggtgatgcgc
gcctacgtggaaaaaccgcgcaccaccgtgggctggaaaggcctggcctacgatccgcac
ctcgacggcagcgatgacatgcacgccggtatcgccctgtcccgtggcctgatgctgggc
atgctcgaacgcggcctgccgatcgccaccgagctgctgcagccgatggccgccggctac
ttcgacgacctgctgggctgggccgccatcggcgcgcgcaccaccgagtcgcagattcac
cgcgagatggtcagtggactggagctgccggtcggtttcaagaacggtaccgacggcggt
atcggcatcgcctgcgacgccatgcgcagcgccgcccacccgcaccgtcacttcggcatg
gacacgcaggggcatccggcgatcatcgagaccctgggcaaccccgacacccacctggtg
ctgcgcggcgggcacaagggcccgaactacgacgcccagagcgtcgccctggcgcgccag
ggcctggccaaggcaggtctggcgccacgcatcatggtcgactgcagccacgccaacagc
ggcaaggacccggcgcgccagccggcggtgttcgaggacgtgctggcccagcgcctgggc
ggtgaccgctcgctggtcggggtgatgctcgagggccacctgttcgacggctgccaggcc
ctgggcaagggcgcgctgaagtacggcgtgtcgattaccgacggctgcctgggctgggac
gccaccgaggcgctgctatgcgacgccgccgcacgcctgtga

DBGET integrated database retrieval system