KEGG   Pseudomonas sp. CCOS 191: CCOS191_4391Help
Entry
CCOS191_4391      CDS       T03967                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00473  D-Alanine metabolism
psec00550  Peptidoglycan biosynthesis
psec01100  Metabolic pathways
psec01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCOS191_4391 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCOS191_4391 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CCOS191_4391 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psec01011]
    CCOS191_4391 (ddl)
Enzymes [BR:psec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CCOS191_4391 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psec01011]
 Precursor biosynthesis
  Amino acid ligase
   CCOS191_4391 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_Ter ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL TUTF7_u4
Motif
Other DBs
NCBI-ProteinID: CRI58927
UniProt: A0A0F7YCY3
LinkDB All DBs
Position
I:complement(4954389..4955345)
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGKAVIEALTNAGVDVVAIDVGDD
LLTRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASEQDCVAASAELGFPLIVKPAHEGSSIGMAKVNSEQELVAAWKDAAN
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAVGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagttgcattcgaccctggacgtcaaggcctttggccgcgtc
gccgtgctgtacggtggcaagagtgccgagcgtgaggtttccctgaagtcgggcaaggca
gtgatcgaggcgctgaccaacgctggtgtcgacgtagtcgccatcgacgtcggcgacgac
ctgctgacccgcctgcagagcgagaagatcgaccgcgccttcatcattctccacggccgt
ggcggtgaagacggcagcatgcagggcctgctcgagtgcctggggattccctacaccggc
agtggcatcctcgcctcggcgctggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggtatccccacgccgcgtcacgccgtgctggccagcgagcaggattgcgtggcc
gccagtgcggaactgggcttcccgttgatcgtcaaacccgcccatgaaggttcgagcatc
ggcatggccaaggtgaacagcgagcaagagctggtcgccgcctggaaagacgccgccaac
tacgattcgcaggtactggtcgagcaatggatccacggcccggaattcaccatcgccgtg
ctgcgtggccaggtgctgccgccgatcgcgctgggcaccccgcacgtgttctacgactac
gacgccaagtacatcgccaatgacacccagtaccgcatcccgtgcggcctggacagcgtc
aaggagcaagagctgatcgaccttaccgcgcgcgcctgcgatgccgttggcatcgagggc
tggggccgtctggacgtgatgcaggacgagcagggccgtttctggctgctcgaggtcaac
accgcaccgggcatgaccgaccatagcctggtgcccatggcggcccgtgccgccggcctg
gacttccagcaactggtgctggcgatcctggccgacagcgtagcgacgagaggttaa

DBGET integrated database retrieval system