KEGG   Pseudomonas sp. R2A2: DM292_09870Help
Entry
DM292_09870       CDS       T05921                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed00071  Fatty acid degradation
psed00280  Valine, leucine and isoleucine degradation
psed00281  Geraniol degradation
psed00310  Lysine degradation
psed00360  Phenylalanine metabolism
psed00362  Benzoate degradation
psed00380  Tryptophan metabolism
psed00410  beta-Alanine metabolism
psed00627  Aminobenzoate degradation
psed00640  Propanoate metabolism
psed00650  Butanoate metabolism
psed00903  Limonene and pinene degradation
psed00930  Caprolactam degradation
psed01100  Metabolic pathways
psed01110  Biosynthesis of secondary metabolites
psed01120  Microbial metabolism in diverse environments
psed01130  Biosynthesis of antibiotics
psed01212  Fatty acid metabolism
Module
psed_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DM292_09870
   00650 Butanoate metabolism
    DM292_09870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM292_09870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM292_09870
   00310 Lysine degradation
    DM292_09870
   00360 Phenylalanine metabolism
    DM292_09870
   00380 Tryptophan metabolism
    DM292_09870
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM292_09870
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DM292_09870
   00281 Geraniol degradation
    DM292_09870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM292_09870
   00627 Aminobenzoate degradation
    DM292_09870
   00930 Caprolactam degradation
    DM292_09870
Enzymes [BR:psed01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DM292_09870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AWT10474
UniProt: A0A2U9NDF2
LinkDB All DBs
Position
2161039..2161812
Genome map
AA seq 257 aa AA seqDB search
MTFETLLVDIQERVALITLNRPQALNALNAQLISELNQALGQLEADPRIGCIVLTGSAKA
FAAGADIKEMAELSYPQVYLDDLFAEADRIATRRKPLIAAVAGYALGGGCELALLCDMIF
AADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVF
PAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQK
EGMAAFSEKRKPEFTNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaaactctgctcgtcgacatccaggagcgcgtcgcgctgatcaccctcaac
cggccgcaggcgctcaatgcgctcaatgcgcagctgatcagcgagctgaaccaggccctg
ggccagctcgaggccgatccgcggatcggctgcatcgtgctcaccggctcggccaaggcg
ttcgccgccggcgccgacatcaaggaaatggccgagctgtcctacccgcaggtctatctc
gatgacctctttgccgaagctgaccgcatcgccacgcgccgcaagccgctgattgccgcc
gtcgccggttacgcgctgggtggtggctgcgagctggcattgctttgcgacatgatcttc
gccgccgataacgcgcgtttcggccagccggaagtcaacctcggcgtgctgccgggcatt
ggcggcacccaacgcctgacccgcgcagtgggcaaggccaaggcgatggacatgtgcctg
accggccgccagatggacgccgccgaagccgagcgcgccggcctcgtcgcgcgcgtattc
ccggccgaaagcctgctggaagaaaccctcaaggccgcccgggtgatcgccgagaaatcc
ctgccggccaccatgatgatcaaggaaagcgtcaaccgcgccttcgagaccacgctggcc
gaaggcatccgcttcgagcgtcgcgtgttccatgcggtgttcgccaccgccgatcagaag
gaaggcatggccgcgttcagcgagaagcgcaagcctgagttcaccaatcgctaa

DBGET integrated database retrieval system