KEGG   Pseudomonas sp. R2A2: DM292_14215Help
Entry
DM292_14215       CDS       T05921                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed00970  Aminoacyl-tRNA biosynthesis
psed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psed00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM292_14215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psed03029]
    DM292_14215
Enzymes [BR:psed01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DM292_14215
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DM292_14215
Mitochondrial biogenesis [BR:psed03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DM292_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWT12714
UniProt: A0A2U9NJ69
LinkDB All DBs
Position
3042745..3044196
Genome map
AA seq 483 aa AA seqDB search
MHNLTLAEIARNLSEKRFSAEELTRTLLTRIEQLDPQLNSFISVTSELAIAQAQAADARR
AAGESDALLGAPIGHKDLFCTQGIRTSCGSKILDSFKAPYDATVVERLAAAGTVTLGKLN
MDEFAMGSANESSYYGPVKNPWDLTRVPGGSSGGSAAAIAARLLPAATGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMVAYASSLDQGGPMARTAEDCALLLSAMAGFDPKDSTSVDQ
PLDDYLAALSQPLAGLRIGLPKEYFGAGLDPKIADAVMAVVEELKKLGATVKDISLPNMQ
HAIPSYYVIAPAEASSNLSRFDGVRFGYRCENPVDLTDLYKRSRAEGFGDEVKRRIMVGT
YALSAGYYDAYYLKAQKIRRLVKNDFVSAFDEVDVILGPTTPNLAWKLGEKNADPVSAYL
EDIYTITANLAGIPGLSMPAGFIDGLPVGVQLLAPYFQEARLLNVAHQYQQVTDWHMRAP
AGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacctgacacttgccgagatcgcccgcaacctcagcgaaaagcgcttctcggcc
gaagagctgacgcgcacgctgctcacccgcatcgagcagctcgatccgcagctgaacagc
ttcatcagcgtcaccagtgagctcgccatcgcccaggcccaggctgccgatgcacgacgc
gccgccggcgagagcgacgcgctgctcggtgcgccgatcggccacaaggacctgttctgc
acccagggcatccgcaccagctgcggctcgaaaatcctcgacagtttcaaggcgccctat
gacgccaccgtggtagaacgactggcagcggccggcacggtcaccctcggcaagctgaac
atggacgaattcgccatgggctcggccaacgagtcgagctattacggcccggtgaagaac
ccttgggacctgacccgggtaccgggcggctcctccggcggttccgccgcggccattgcg
gcgcgcctgctgcccgccgcaaccggcaccgacaccggcggctcgatccgccagccggcc
gcgctgaccaacctcaccggcctcaagccgacctatggacgcgtctcgcgctggggcatg
gtggcctacgcctcgagtctcgatcagggcggtccgatggcgcgcaccgccgaagactgc
gcgctgctgctctcggcaatggccggcttcgacccgaaagactccaccagcgtcgaccag
ccgctggacgactacctcgccgcccttagccagccgctcgccgggctgcgcatcggcctg
ccgaaggaatacttcggtgccggcctcgacccgaagatcgccgacgcggtgatggcggtc
gtcgaggaactgaaaaagctcggcgccacggtcaaggacatcagcctgccgaacatgcag
cacgcgatcccttcctattacgtgatcgcgccggccgaggccagctccaacctgtcgcgc
ttcgacggcgtgcgcttcggctatcgctgcgagaacccggtcgatctgaccgacctctac
aagcgctcgcgcgccgaaggcttcggtgacgaggtcaagcggcgcatcatggtcggcacc
tatgcgctgtcggccggctactacgatgcctactacctcaaggcgcaaaagattcgccga
ctggtcaagaacgacttcgtcagcgcgttcgatgaggtcgacgtgatcctcggcccgacc
acaccgaacctggcctggaagctgggcgagaagaacgccgatccggtttccgcctatctg
gaagacatctacaccatcaccgccaacctggcgggcatccccggcctgtcgatgccggcc
ggcttcatcgatggcctgccggtgggtgtgcaactgctggcgccgtacttccaggaagcg
cgcctgctcaacgtggcgcaccagtatcaacaagtcaccgattggcacatgcgcgccccg
gccggattctga

DBGET integrated database retrieval system