KEGG   Pseudomonas sp. R2A2: DM292_16755
Entry
DM292_16755       CDS       T05921                                 

Definition
(GenBank) histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed01503  Cationic antimicrobial peptide (CAMP) resistance
psed02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psed00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM292_16755
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DM292_16755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psed01001]
    DM292_16755
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psed02022]
    DM292_16755
   01504 Antimicrobial resistance genes [BR:psed01504]
    DM292_16755
Enzymes [BR:psed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DM292_16755
Protein kinases [BR:psed01001]
 Histidine kinases
  OmpR family
   DM292_16755
Two-component system [BR:psed02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   DM292_16755
Antimicrobial resistance genes [BR:psed01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    DM292_16755
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HisKA PhoQ_Sensor HATPase_c_2 CorA HAMP
Other DBs
NCBI-ProteinID: AWT11738
UniProt: A0A2U9NEM2
LinkDB
Position
3561430..3562827
AA seq 465 aa
MSRRWRRLQARIRTRLGGAMSLRLRLMLGAASLAALFMLVLLPVLQGAFSLTFERVIEQR
LAADANTLITAAQVEENRLQMPERLPDEEFNLPDARLLGFIYDRRGELVWRSRSAADERI
DYRPRYEGGTTEFLRVRDEAGTEYFAYDVELHLAGSRDNAFSFVTMQPTSEYLSLFEEFR
RQLYLWLGSGLLVLLALLWLGLTWGFRTLKRVSAELDQVEAGQRERLSDDHPRELLRLTR
SLNRLLDSERRQREQYRNSLGDLAHSLKTPLSVLQGVGETLAAQTQSREQAQVMQAQIER
MSQQIGYQLQRASLGKSGLVRHRVELRPLLDSLCSTLDKVYRDKHVQVDVQLAEPCQVPI
EQGALMELLGNLLENAYRLCLRQIRISARTHDGDLLLGIEDDGPGVPVDQRARIIRRGER
LDAQHPGQGIGLAVVKDILDSYGGELSLGESALGGAAFRIRLQAD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagtcgacgctggcgccggctgcaggcgcgcatacgaacccgtctgggcggtgcgatg
tcgctgcgtctgcgtctgatgctcggcgccgcaagcctggccgcgctgttcatgctggtc
ctgctgccggttttgcagggcgctttcagcctgaccttcgagcgggtcatcgagcagcgc
ctggcggccgatgccaatacgctgatcaccgccgcccaggtcgaggagaaccggctgcag
atgcccgagcggctaccggacgaggagttcaacctgccggatgcacgactgctcggtttc
atctacgaccgccgcggcgagctggtctggcgttcccgctcggccgccgacgagcgcatc
gactaccgcccgcgctatgagggcggcaccaccgagttcctgcgcgtgcgcgacgaagcc
ggaacggaatacttcgcctacgacgtcgagctgcacctggccggcagccgcgacaatgcg
ttcagcttcgtcaccatgcagccgaccagcgaatatctcagcctgttcgaggagtttcgc
cggcagctctacctgtggctgggcagtggcctgctggtgctgctggccctgctctggctc
ggcctgacctggggcttccgcaccctcaagcgggtcagcgccgagctcgaccaggtcgag
gccgggcagcgcgagcgcctgagcgacgaccacccgcgcgaactgctgcgcctgacccgc
tcgctgaaccgcctgctggacagcgaacggcggcaacgcgagcagtaccgcaactccctg
ggcgacctggcgcacagcctgaagacgccgctaagcgtgctgcagggcgtcggcgagacc
ctcgccgcgcagacgcagagccgcgaacaggcccaggtgatgcaggcgcagatcgaacgc
atgagccagcagatcggctatcagctgcagcgcgccagcctcggcaagagcggcctggtg
cgccaccgggtcgagctcaggccattgctcgacagcctgtgcagcacgctggacaaggtc
taccgcgacaaacacgtgcaggtcgacgtgcagctcgccgagccatgccaggtgccgatc
gaacaaggcgcgctgatggagctgctcggcaatctgctggagaacgcctaccggctctgt
ctccggcagatccgcatcagcgcacgcacgcatgacggcgacctgctgctcggcatcgag
gacgacggccccggcgtgccggtggaccagcgcgcgcgcatcatccgccgtggcgaacgc
ctcgacgcccagcatcccggccagggcatcggcctggcggtggtcaaggacatcctcgac
agctacggcggcgaactcagcctgggcgagtcggcgctcggtggcgcggcttttcgcatc
cgcctgcaggccgactga

DBGET integrated database retrieval system