KEGG   Pseudomonas sp. R2A2: DM292_18660
Entry
DM292_18660       CDS       T05921                                 

Gene name
tagH
Definition
(GenBank) type VI secretion system-associated FHA domain protein TagH
  KO
K11894  type VI secretion system protein ImpI
Organism
psed  Pseudomonas sp. R2A2
Brite
KEGG Orthology (KO) [BR:psed00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psed02044]
    DM292_18660 (tagH)
Secretion system [BR:psed02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   DM292_18660 (tagH)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AWT12084
UniProt: A0A2U9NI11
LinkDB
Position
3978169..3979368
AA seq 399 aa
MELVFDMVGAQQFVPGLLTTKTFKQAGGVIGRAEGCDWVIPDRKRVLSGRHAVISYRDGA
FFLTDTSSNGIQLKDSGASLVKGQPQRIEHGSVYCLGDFEIRARLIQDPALFEGDIGRPQ
PAGSIIPDDAFLDLDPLVAMEQQERVYAEVDDLDLALVAPQRQAQQQRDYARIDMESLPL
PELVMPQAAPQAKREAEPERLPQGFWARFGEALGIDLDDLDEDQRQALALNAARLLKHSV
AGLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSADASEALNALLRGGKPGQLSAEQAV
GRAFRDLQAHQVALLAASRAAVHAMFEQLAPEQLALRFEREGRKPLLATAGSRWRAYRRL
HHSLGQDADWSERLFARDFAKTYEEQVRLIATLDSTHQG
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaactggtcttcgatatggtgggcgcccagcaattcgtgccggggctgctgaccacc
aaaaccttcaagcaggccggcggtgtgatcggccgcgcagagggctgcgattgggtgatc
cccgaccgcaagcgcgtcctctccggccgtcacgcagtgatcagctaccgcgacggcgcc
ttctttctcaccgataccagcagcaacggcatccagctcaaggacagcggcgccagcctg
gtcaagggccagccgcagcgcatcgagcatggcagcgtctactgcctgggcgatttcgag
atccgcgcccggctgatccaggatccggcgctgttcgaaggtgacatcggtcgtccgcag
ccggctggcagcatcatccccgacgatgccttcctcgacctcgatccgctggtcgcgatg
gaacagcaagagcgcgtctatgccgaggtcgacgacctcgacctcgctctggtagcgcca
cagcgccaggcgcagcagcagcgcgactacgcgcgcatcgacatggaaagcctgccgttg
ccggagctggtcatgccgcaggcagcaccgcaagccaagcgcgaagccgagcccgaacga
ctgccgcagggattctgggcgcgtttcggcgaggcgctgggcatcgatctcgacgatctc
gacgaggaccagcgccaggccttggcgctgaatgccgcccgcctgctcaagcatagcgtg
gcgggcctacagcagagcctgcggacccgcagcgagctgaaaaacgagctgcgcctggcg
ttgaccaccgtgcagagcgccggcaacaacccgctcaagcacagcgccgatgcgagcgag
gccctgaacgcccttttgcgcggtggcaaacccggccagctcagcgccgaacaggccgtc
ggccgagcctttcgtgatctgcaggcgcatcaggtggcactgctggcggccagccgcgcc
gccgttcacgcgatgttcgaacagctggcgccggagcagctggcgctgcgcttcgaacgc
gaaggccgcaaacccctgctcgccaccgccggcagtcgctggcgtgcctatcgccgcctg
catcacagcctcggccaggatgccgactggagcgaacgcctgttcgcccgcgacttcgcg
aagacctatgaggagcaagtgcgcctgatcgccacgctcgattcaacccatcaaggatga

DBGET integrated database retrieval system