KEGG   Pseudomonas sp. R2A2: DM292_19910
Entry
DM292_19910       CDS       T05921                                 

Gene name
tssC
Definition
(GenBank) type VI secretion system contractile sheath large subunit
  KO
K11900  type VI secretion system protein ImpC
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psed00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    DM292_19910 (tssC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psed02044]
    DM292_19910 (tssC)
Secretion system [BR:psed02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DM292_19910 (tssC)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AWT12317
UniProt: A0A2U9NGE0
LinkDB
Position
complement(4243834..4245312)
AA seq 492 aa
MTTSAAAVEHGNHLAEGGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPV
KKAMVDRMIAEIDAKLSQQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLELLNAS
KQDLLDDFEDSPEIVQSGLYKHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTMQYVAS
VASMSHAPFIAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFTKWQSFREQEDARYVGLTV
PRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYAFASRLTDSFAKFRWCPNIIG
PQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFS
ANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSAEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGAD
FTLSLVGKLDKE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaccactagcgcagccgccgtcgagcacggcaaccacctcgccgaaggcggcatcctc
gaccgcatcatcgccgaaacccgcctgaccccggacgacgaggcctacgacatcgccaag
cgcggcgtctcggccttcatcgaagaactgctcaagccacagaacgaaaacgagccggtg
aagaaggccatggtcgaccgcatgatcgcggagatcgacgccaagctcagccagcagatg
gacgagatccttcaccacccgcagttccaggccctcgagtcctcctggcgcggcctgaag
ctgctggtggatcgcaccaacttccgcgagaacatcaagctcgagctgctcaacgcctcc
aagcaggacctgctcgatgacttcgaggacagcccggagatcgtccagtccggcctgtac
aagcacatctacaccgccgagtacggccagttcggcggccagccggtcggtgcgctgatc
gccaactacttctttgaccccagcgcacccgacgtgaagaccatgcagtacgtcgccagc
gtcgcgagcatgtcccacgcccccttcatcgccgccgccggcccgaaattcttcggcctg
gaaagcttcaccggcctgccggacctgaaggatctcaaggatcacttcgagggcccgcag
ttcactaagtggcaaagcttccgcgagcaggaagatgcccgctacgtcggcctgaccgtt
ccgcgcttcctgctgcgcaacccctacgatccggaagacaacccggtgaagagcttcgtc
tacaaggaaaacgtcgccggcagccacgagcactacctgtggggcaacaccgcctacgcc
ttcgccagccgcctgaccgacagcttcgccaagttccgctggtgcccgaatatcatcggc
ccgcagagcggtggcgctgtggaagacctcccgctgcaccacttcgagagcatgggcgag
atcgagaccaagatcccgaccgaggtgctggtttccgaccgtcgcgagtacgagctggcc
gaagaaggctttatcgccctgaccatgcgcaagggcagcgacaacgccgcgttcttctcc
gccaactcggcgcagaagccgaagttcttcggcaacagcgaggaaggcaagaccgcggag
ctgaactacaagctcggcacccagctgccctacctgttcatcgtcaaccgcctggcgcac
tacctgaaggtgctgcagcgcgagcagatcggtgcctggaaggagcgcaccgacctcgag
ctggaactgaacaagtggatccgccagttcgtcgccgaccaggagaaccccagcgccgaa
gtccgcagccgtcgcccgctgcgtgccgcccaggtcaacgtcagcgacgtcgagggcgag
ccgggctggtaccgcgtcagcctaagcgtgcgtccgcacttcaagtacatgggcgcggat
ttcaccctgtcgctggtcggcaagctggacaaggaataa

DBGET integrated database retrieval system