KEGG   Pseudonocardia sp. EC080625-04: FRP1_03840
Entry
FRP1_03840        CDS       T04054                                 

Definition
(GenBank) hypothetical protein
Organism
psee  Pseudonocardia sp. EC080625-04
SSDB
Motif
Pfam: Prominin 7TM-7TMR_HD
Other DBs
NCBI-ProteinID: ALE72465
LinkDB
Position
834322..834666
AA seq 114 aa
MSALVLGVLGAVFVAIAVAYSIVAPLTVTGLALVSAGVVLTLAGLVLGTIGATRGSARAN
RAAISAAGVSVAGLAGGLIWLAAFVITTLTGPVPVVAQYMGGTPACAPPTCHAP
NT seq 345 nt   +upstreamnt  +downstreamnt
gtgtcggcgctcgtgctcggggtcctcggcgccgtcttcgtcgcgatcgccgtggcgtac
tcgatcgtcgccccgctcaccgtcaccgggctggcgctggtctcggccggtgtcgtcctg
acgctcgccgggctcgtcctcggcacgatcggcgcgacccgcgggagtgcacgggcgaac
cgcgccgcgatctccgctgcgggcgtctcggtcgccgggctcgccggcgggctgatctgg
ctggccgccttcgtgatcacgacgctcaccgggccggtcccggtcgtcgcccagtacatg
gggggcacccctgcctgcgcgcccccgacctgccacgccccctga

DBGET integrated database retrieval system