KEGG   Pseudonocardia sp. EC080625-04: FRP1_18630Help
Entry
FRP1_18630        CDS       T04054                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
psee  Pseudonocardia sp. EC080625-04
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DUF3509 LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: ALE74485
LinkDB All DBs
Position
4026516..4027586
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKPASSIPDGRLYEPKWDGFRSIVFRDGDDVEIGSRNERPMTRYFPE
VVEAVRANFPDRAVIDGEIVVADPANNRLDFEALQQRIHPAASRVTLLSTETPASFVAFD
LLALGADDLTGLPFAERRDLLESALADAAPPVHLTPVTDDTGTARRWFDRFEGAGLDGLI
AKDPAGTYQPDKRVMTKIKHERTADCVVAGYRVHKSGPDAVGSLLLGLHDERGVLVSVGV
VGAFPMARRRELMTELQPLVTGFDEHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLR
PERVVEVRYDYMEGARFRHTTQFVRWRPDRAPESCTYEQLDRPVGFDLAEVLAGRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctcgccaagcccgcgtcgtcgatc
cccgacggccggctgtacgagcccaagtgggacggcttccgctcgatcgtcttccgggac
ggtgacgacgtcgagatcggctcccgcaacgagcggccgatgacgcgctacttccccgag
gtcgtcgaggcggtgcgggcgaacttcccggaccgcgcggtgatcgacggcgagatcgtc
gtcgcggaccccgcgaacaaccgcctcgacttcgaggcgctccagcagcggatccatccc
gccgcgagccgggtgacgctcctgtcgaccgagacgccggcgtcgttcgtggcgttcgac
ctgctcgcgctcggcgccgacgacctgaccgggctgccgttcgccgagcgtcgcgacctg
ctggagtccgcgctcgccgacgccgccccgccggtgcacctcacccccgtcaccgacgac
accggcaccgcccggcgctggttcgaccggttcgagggcgccgggctcgacggcctgatc
gcgaaggacccggcggggacctaccagccggacaagcgcgtcatgaccaagatcaagcac
gaacggaccgcggactgcgtcgtcgccgggtaccgggtgcacaagtccgggccggacgcc
gtcgggtcgctcctgctcggcctgcacgacgagcgcggggtgctggtgtcggtcggtgtc
gtcggcgcgttcccgatggcacgcagacgggagctgatgaccgagctccagccgctggtc
accggcttcgacgagcacccgtgggcctgggcgaagcagctcgagggcgagcgcaccccg
cgcaagtccgagacgagccgctggaacgccggcaaggacctctcgttcgtgccgctgcgc
ccggagcgggtcgtggaggtgcgctacgactacatggagggcgcccggttccggcacacc
acccagttcgtgcggtggcgcccggaccgcgccccggagtcgtgcacctacgaacagctg
gaccggccggtcgggttcgacctggccgaggtcctcgcgggccgcggctga

DBGET integrated database retrieval system