KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_08925Help
Entry
D3H65_08925       CDS       T05640                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 Pyr_redox_2 3HCDH_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AXY78573
UniProt: A0A3B7MYD0
LinkDB All DBs
Position
complement(2410831..2411850)
Genome map
AA seq 339 aa AA seqDB search
MQTLICTSPGHFNWGTSMRPVMKKDHAIIAIKRIGICGTDLHAYQGTQPYFTYPRILGHE
LSGTLIEFDNAPGFNVGEAVTFIPYFNCGHCIACRSGKPNCCVSIQVFGVHIDGGMCEYV
QVPSYALVHGESLTYDELALVEPLAIGAHGIRRAGVEKDDFVLVIGAGPIGIGAMEFARI
AGGKVIAMDVSDDRLAFCSRRVGIEHVINPLHGDAMEWLSTYTNGDMASVVIDATGNLKA
INAGINYLAHGGRYVLIGLQKEAFSFSHPEFHKRESTLMSSRNATRQDFEHVVAAMKKGW
VDPTAYITHRTPFDHVIRDFESWLQPETQVIKAMVSIDH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacattgatatgtacttcccccggccactttaattggggaacgagtatgcgcccg
gtcatgaaaaaggaccatgccattattgcgataaagcgcatagggatatgtggtactgac
cttcatgcttaccagggaacacaaccttattttacctatccccgtatactggggcacgaa
ctgtcgggaacgctgatcgaatttgacaatgcgcccggatttaatgtgggagaagctgta
acatttatcccttactttaattgcggacattgtattgcctgtcgttcgggtaaacccaac
tgctgtgtgagcatacaggtctttggtgtgcatatcgacggaggcatgtgtgagtatgta
caggtgccttcttatgcgcttgtacatggagaaagtcttacatacgatgaactggcattg
gtagaaccgctggctatcggggcacatggtatccgaagggctggcgtggaaaaagatgat
tttgtactggtcataggggcaggccctattggcattggcgccatggagtttgcccgtatt
gccggtgggaaagtaatagcgatggatgtaagcgacgaccggctggccttttgcagtcgc
cgggtaggtattgagcatgtcatcaacccactgcacggtgatgctatggagtggttaagc
acttatactaatggcgatatggcctctgtagtgattgatgctaccggcaacctgaaggcc
attaatgctggtatcaactacctggcccatggcggtcgctacgtgctgatagggttgcaa
aaagaagctttcagtttcagtcatcctgaatttcacaagcgtgaatctactctaatgagc
agccgcaatgcgacaaggcaggattttgagcatgtggtagctgcgatgaaaaaaggatgg
gtagatcctacagcctatattacacaccgaacgccattcgaccatgtaatacgggatttt
gaaagctggttacagccggaaacacaggtgatcaaagccatggtcagtattgatcattaa

DBGET integrated database retrieval system