KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_15115Help
Entry
D3H65_15115       CDS       T05640                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00473  D-Alanine metabolism
pseg00550  Peptidoglycan biosynthesis
pseg01100  Metabolic pathways
pseg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D3H65_15115
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D3H65_15115
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D3H65_15115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pseg01011]
    D3H65_15115
Enzymes [BR:pseg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D3H65_15115
Peptidoglycan biosynthesis and degradation proteins [BR:pseg01011]
 Precursor biosynthesis
  Amino acid ligase
   D3H65_15115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter GARS_A ATPgrasp_YheCD ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AXY75231
UniProt: A0A3B7MY35
LinkDB All DBs
Position
complement(4086694..4087689)
Genome map
AA seq 331 aa AA seqDB search
MKPVIAFVTGGYSTEAVISYKSAVTIENNIDTSKFEVFKIDVTTEGWWYETTTGRKIAVD
RSDFSITADGRKVTFDAVLIGIHGTPGEDGKLQGYFDLMGIPYTSCDAATSAITFNKRYT
VAVAAFAGIHVAKSLHIFKHSPVTPAEILKQVSLPVFVKPNNGGSSIGMSKVYKAEDLAS
ALEKAFREDDQLLIEEFIAGREFTVGVFKTTEGIIVLPITEVATDKDFFDYEAKYQGKST
ETTPAKIEEHMADIIRKTARKVYEVFNCRGVVRIDFIYNEAKNAPYMLEINTVPGQSEAS
IVPQQVQVMGWSLKDFYSSLIEDALDRGKKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgttattgcctttgttaccggtggctattctacagaagccgtgatctcctat
aaaagcgctgttaccattgaaaacaacatcgataccagcaaattcgaggtctttaaaatc
gacgttactaccgaaggctggtggtatgagaccactacaggtcgcaaaatagctgtcgac
cgtagcgacttctccattacagctgatggccgtaaggtcactttcgatgccgtcctcatt
ggaattcacggtacccccggcgaggatggaaaactgcagggatacttcgacctcatgggc
attccctacacttcctgcgacgcagctacctccgccatcactttcaacaaacgctatacg
gtggctgtggcggcttttgcaggcatacatgtggccaaatctttgcatattttcaaacat
agtcccgttaccccggcagaaatattaaaacaggtcagtctccctgtattcgttaagccc
aacaatggtgggtccagcattggcatgagtaaagtgtacaaagccgaagacctggcctcg
gccctcgaaaaagctttccgggaagacgaccagctcctgatcgaagagtttattgctggc
agggaatttacagtaggtgtattcaaaaccaccgaaggcatcattgtattgccgatcact
gaagtagcaaccgataaggatttcttcgattatgaggccaaataccagggtaaaagcacc
gaaacgaccccggcgaagatagaagagcacatggccgatattattcgcaaaaccgcacgg
aaggtctatgaagtgttcaactgtcgcggtgtagtacgtattgattttatttacaatgag
gccaaaaatgcgccttatatgctggagatcaatactgtgcccggccaaagcgaagccagc
atagtacctcagcaggtgcaggtaatgggttggagcctcaaggatttttattcctccctc
atcgaagatgccctcgaccgtggaaaaaagaaataa

DBGET integrated database retrieval system