KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_20570Help
Entry
D3H65_20570       CDS       T05640                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00564  Glycerophospholipid metabolism
pseg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D3H65_20570
Enzymes [BR:pseg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D3H65_20570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA FAD_binding_3 HI0933_like Pyr_redox_2 NAD_binding_8 Thi4 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AXY76237
UniProt: A0A3B7MR14
LinkDB All DBs
Position
5478104..5479678
Genome map
AA seq 524 aa AA seqDB search
MNRKQQIEQLEANSAPWDIIIIGGGATGLGAAVDAAARGYRTILFEQADFAKGTSSRSTK
LVHGGVRYLQQGNIKLVMDALKERGILKQNAPHLVKNQSFIVPNYKWWEGPYYGLGLKVY
DWMSGSLGLGTSAWLSTEEVLELAPTLDTEGLRGGVLYHDGQFDDARLAINLAQTAVEQN
GVILNYFKVTGLLKTQDKMAGVQVKDEVTGKTYEVQGKVVINATGVFSDAVQQMDDAQKP
TSIAPSQGIHVVLDKEFLPGEAAIMIPHTDDGRVLFAVPWHQKIIVGTTDTSVDHISDEP
IAQEDEIQFILEHAARYLTKDPTREDVKSIFAGLRPLVKSTAKKTAEISRDHSILVSDSG
LVSILGGKWTTYRKMAADVINIAAVQGALAYKEPVTKDLAIHGAMPTTDYSTADYYYGTD
KAGIEKLVAGQPELGVLLHPSLPYNKATIIWAVQEEMCMTIEDALSRRTRALLLDAKAAI
EAAPLVAALMAAAMNQGADWIQEQLTTFYAIANNYLPEKAKSEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaaacaacagatagaacaactcgaagcgaatagtgctccctgggacattatt
attatcggtggcggcgccacgggtctcggcgcagcagtagatgctgccgcacgcggctac
cgtaccattctttttgaacaggccgattttgccaaaggcacttcttcccgctctaccaaa
ctggtgcatggcggcgtacgttacctgcagcaaggcaatattaaactggtgatggatgca
ttgaaagaaaggggcatcctcaaacagaatgcaccccacctggtgaaaaaccagtcgttt
atcgttcccaattataaatggtgggaaggtccttattatggtcttggtttaaaggtatac
gactggatgagcggtagcctcggactgggcacctctgcctggctgtccacagaagaagta
ttggaactggcccctaccctcgatacagaagggctgcggggtggcgtactataccacgac
ggtcagtttgatgatgcccggttggccatcaacctcgcgcagacggccgtagagcaaaac
ggtgttatcctgaattatttcaaggtaacgggacttttaaagacacaggataaaatggct
ggcgtgcaggtgaaagatgaggtgacgggcaagacctatgaagtacagggcaaggtagtg
atcaatgccaccggggtattctctgacgcagtacaacaaatggatgacgcgcagaagcct
accagcattgcccccagccagggcattcacgtagtgcttgacaaagaattcttaccgggc
gaagccgccatcatgatcccgcataccgacgatggccgtgtattgtttgctgtaccctgg
caccagaaaattatagtaggtactacagatacctcggttgatcatatctcagatgaaccg
atagcgcaggaagatgagatacaattcatcctggaacatgcggcacgttatcttaccaaa
gatcccacgcgggaagatgtgaagagcatttttgccggcctgcggccattggtgaaaagc
acggctaagaagacagccgaaatatcgcgcgatcattcgatccttgtttcagacagcggg
ctggtcagcatcctgggtggtaagtggacgacctaccgtaaaatggcggcggatgtgatc
aatatcgctgctgtgcaaggtgccctggcatacaaagaaccggtaacaaaagacctcgct
atccatggcgccatgcctactacggattattccaccgcagattattattatggcactgat
aaagctggtattgaaaagctggtagcaggccagccggaactaggcgtcttgttgcatccc
agcctgccttataataaggccaccatcatatgggctgtacaggaggaaatgtgtatgacc
attgaagatgctttaagccgccgcaccagggctttgctgcttgatgccaaagcagccata
gaagcagcccccctggtggcagcactcatggcagctgccatgaatcaaggtgcggattgg
atacaggaacaactgacaaccttctatgctatagccaacaattatttacctgaaaaggca
aaaagtgagttgtga

DBGET integrated database retrieval system