KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_24695Help
Entry
D3H65_24695       CDS       T05640                                 

Definition
(GenBank) efflux RND transporter permease subunit
  KO
K18138  multidrug efflux pump
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg01501  beta-Lactam resistance
pseg01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D3H65_24695
   01503 Cationic antimicrobial peptide (CAMP) resistance
    D3H65_24695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pseg02000]
    D3H65_24695
   01504 Antimicrobial resistance genes [BR:pseg01504]
    D3H65_24695
Transporters [BR:pseg02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   D3H65_24695
Antimicrobial resistance genes [BR:pseg01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    D3H65_24695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: AXY76988
UniProt: A0A3B7MS60
LinkDB All DBs
Position
6465696..6468848
Genome map
AA seq 1050 aa AA seqDB search
MSAISQMSISRPVLAGVMSVLLILFGIVGYTFLGTREYPVTDSPIVTVTTVYPGASADII
ASQVTKPLEEAVAEANGIRAMSSVSREQVSIITVEFNLNADLEAAANDVRDKVSKSRQQL
PTDIEPTIVEKSGPADFLVFLTVQSDTRSLEDITDFVNINIKERLQSIPGVRLVDSYAGR
KRAMRLRMDPVKLAAYGLTPNDIQTALQRENVDLPSGRIEGQNTEVTLRTQGRLVTEEDF
NNMIISQKDGAIVRFRDIGNAIMSSQNERTAMIVAEGKKAQYGVGTGVQPQRGANSLAIV
EEFKTRFADIVKSAPKDYNITLGKDFTVPVRNSLSEVEETLLLAFGLVTLIIFIFLRDWR
STLIPLVAIPVSIISAFFIMYLGDFSINVLTLLGMVLAIGLVVDDAIVVLENIYSKVEEG
MKPLEAARKGSNEIYFAVISTTVTLAAVFLPILFLGGITGRLFKEFAIVVAGSVLISAFV
ALTLSPMMSAYLLKPGASHGWLYRKTEPFFVSLNNGYERSLKAFMRYRWVGIVLLLGSFG
IAYWLAPKLPSELAPLEDRSMVGLAVIAPEGTSYESMEETMKEINAYVSDSIPDLNNNTT
YAGIAATVGTLVQPVNGGFQWIFLEDPKVRKSKMSQQQIYEKLVVASQRFRNVILIPIQI
PTIGGFSTSQPIEYVVQAPTLDSLIAVMPRLMGEVYKSKKLAFPNPDFKVNRPEISISID
RQRAAQLGISTQEIGRTLQLALSGRRYGYFIYNDRQYEVIGQLDRVERSTPENLRSLFLK
SASNEMVSLDNLVSLKEGISPPAIYRYNQSYSVTIGATPAPGVSLGEGIKELDNITASVL
PKGFRTQLAGQSRDFAESSSSLIFAFIFAILLIYLVLAAQFESLIDPFIILLTVPMAVTG
ALLSLWFTGESINIFSQIGIIMLIGLITKNGILIVEFANHRKQEGLKVKDAVISAATSRF
RPILMTTLAMIFGTLPIALSLGTSSGSRTSLGIVVVGGLIFAGILTLYVIPSVYSYFSRP
AKKTSGEEGALPHGGVPVPAPVTLNTNASI
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccatttctcaaatgagcatctccaggcctgtattggccggagtgatgtccgtt
ttgctaattcttttcggtatcgtaggatacaccttcctcggtacccgcgaataccctgtc
actgattcacccatcgttaccgttactaccgtctatcccggggccagcgccgatatcatt
gcttcccaggtaaccaagcccctcgaagaagccgtggccgaggccaatggcatcagggct
atgtcttccgtttcgcgtgaacaggtaagtatcatcaccgttgagttcaacctcaacgcc
gatctcgaagcagccgcgaatgatgtgcgcgataaagtatccaagtcgcgccagcaactg
cccaccgatattgaacccaccatcgtggaaaaatcaggaccggccgacttcctcgtgttc
cttaccgtacaaagcgatacccggagcctggaagatatcaccgactttgtcaacatcaat
attaaagaaagactacagtctattcccggtgttcgcctcgtagatagctatgcaggccgc
aaaagagccatgcgcttacgcatggacccggtaaagctggccgcctacggacttaccccc
aatgatatccagaccgccctccagcgcgagaatgtcgatttgcccagtggccgtattgaa
ggacagaatacagaagtaaccctgcgtacccaggggcgactggtgactgaagaggacttc
aacaatatgatcatctcccagaaggatggcgctattgtgcgcttcagggatattggtaat
gccatcatgtcttcccagaacgaacgcaccgctatgatcgtggccgaaggaaagaaagca
cagtatggtgtgggcacaggtgtacagccccagcgtggcgccaactccctggccattgtg
gaagagttcaagacccgctttgcggatattgtgaaatcggcgccgaaagattataatatc
acccttggcaaagacttcaccgtacctgtccgcaactcactctccgaagtggaagaaacc
ttattactggcctttggccttgttactctcatcatcttcatattcttacgcgactggcga
agtacgctgataccgttggtggccatccccgtatccatcatatccgcgttcttcatcatg
tacctgggcgacttctccatcaacgtacttaccctgctgggcatggtactggccatcgga
ctcgtggtggatgatgccattgtggtgctggaaaatatatatagtaaagtagaagaaggt
atgaagcccctggaagccgcacgaaagggctccaatgaaatatattttgccgtcatctct
accaccgtcaccctggccgccgtgttcctgcccatcttattcctgggtggtattaccggc
cggttgtttaaagagtttgccatcgtggtagcaggttccgtattgatctccgcttttgtg
gcattgaccctttctcctatgatgagcgcctacctcctgaagccaggcgcttcccatggc
tggttgtaccgcaaaactgaacccttctttgtaagcctcaacaatggatatgaacgttcc
ctcaaagcattcatgcgctatcgctgggtaggtattgtattgctactgggttctttcggt
atcgcttattggctggcccccaagctgccctctgaactggcgcccctggaagacaggtca
atggtgggcctcgctgtcatagctcctgagggtacttcctatgaaagcatggaagagacc
atgaaggagatcaacgcctatgtatccgattctattcccgacctcaacaacaatactacc
tatgcaggtatagccgctaccgtgggtaccctggtacaacctgtaaatggcggtttccag
tggatattcctggaagatcccaaggtccggaaaagtaaaatgagccagcagcagatctat
gaaaagttggtagtagcttctcagcgttttcgcaacgtgatcctcatccccattcagata
cctaccatcgggggcttctctacttcacagcccattgaatatgtagtacaggcgcctacc
ctggacagcttaatagcagtaatgccaaggctgatgggtgaagtatataaaagcaagaag
ctggcgttccccaaccccgactttaaagtaaaccgccccgagatcagtatttccatcgac
cggcagcgcgcagcacagttgggtatttccacacaagagataggccgtaccttacaactg
gccctcagcggtcggcgttatgggtactttatttacaacgaccgtcagtatgaagtaata
ggtcagctcgatcgcgtggaaagatcaacccccgagaacctgcgctccttattcctgaag
tctgccagcaatgaaatggtgtcactcgacaacctcgtgagcctgaaagagggcatcagc
ccacccgccatctatcggtataaccaatcttacagcgttaccattggcgctacacctgcg
cccggtgtaagcttaggcgagggcatcaaagagttggacaacatcactgccagcgtacta
cccaaagggttcagaacacagctggccggccaaagccgcgattttgcggaaagcagttcc
agtttgatcttcgctttcatctttgccatattgttgatctacctcgtactcgcggcacag
ttcgaaagcctcatagaccctttcattatcctgttgacagtgccgatggccgttaccggc
gcattgctgagcttatggtttaccggtgagtctatcaatatctttagtcagatcggtatc
atcatgctcattggtttgattaccaaaaatggtatcctcattgtagagtttgccaaccat
cgcaaacaggaaggactcaaagtgaaagatgctgttatttcagccgctacctcacggttc
cgtcccatcctcatgactaccctggctatgatcttcggtacactgcccattgccttgtca
ctcggtacatcttccggaagccgtacctctctcggtattgtggtagtgggtggtttgatc
ttcgccggtatccttacattatatgttatcccgtccgtgtattcttatttctcacggcct
gctaagaaaacatcaggtgaagagggtgcgctgcctcatggtggagttcctgtacccgca
cccgttaccttgaatacaaatgcatcaatatga

DBGET integrated database retrieval system