KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_26520Help
Entry
D3H65_26520       CDS       T05640                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00473  D-Alanine metabolism
pseg01100  Metabolic pathways
pseg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D3H65_26520
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D3H65_26520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pseg01011]
    D3H65_26520
Enzymes [BR:pseg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D3H65_26520
Peptidoglycan biosynthesis and degradation proteins [BR:pseg01011]
 Precursor biosynthesis
  Racemase
   D3H65_26520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C POTRA_2
Motif
Other DBs
NCBI-ProteinID: AXY77319
UniProt: A0A3B7MVS6
LinkDB All DBs
Position
6881623..6884121
Genome map
AA seq 832 aa AA seqDB search
MKYYIEDIAPIVKGTLLQQQKNVFIEHLLTDSRKLIFPATSLFFAIKGPRRDGHGFLEAL
YEKGVRNFVVSDVVEVTNIPEANIIQVKDVLQALQLLAAHHRKQFSIPVIGITGSNGKTI
VKEWLNQLLDDQYTIIRSPRSYNSQIGVPLSVWPMNETHELGIFEAGISQSGEMERLQKI
IQPTIGIFTNIGEAHSEGFLNLRQKVNEKLRLFTHVKTMVYCKDAPEINEGVATLWQQFN
KGGKGSFDIFNWSTVTEATLQVLTIYKEGGTTLITALYKEQTIGITIPFTDDASVENAIH
CWCVLLQLEVKPRIIAQKMLQLAPVAMRLELKKGVNNCSIINDSYSADLSSFNIALDFLS
QQRQHVRKTVILSDILQSGRNEKELYKEVAQALSQRGVSRLIGIGEKMILHQGIFRLAPI
PELAFYPSVESFKHDFHHLVFRDETILLKGARVFELEQIDRLLEQKVHQTVLEIDLNALA
HNLRQYQQLLKPATKLMAMVKAFSYGSGSYEIANALQFHKVDYLAVAYADEGVELRRGGI
NLPIMVMNADETTFDVLVQYNLEPDLYSPGLLQAFEAFLKGEGIRQFPVHIELETGMNRL
GFSPAELPVLLEALKGDTFTVKSVFSHLAASEEKQHDAFTEQQAAIFHTMVKQLQAVIAY
PFLRHIDNTAGIARHPDLQLDMVRLGIGLYGIDSGNTHKLELKEVSTLIATIAQIKHLKA
GETVSYGRKGVVSRNTTVATVRIGYADGYPRNLSNGIGKMWVKGMLAPVIGTVCMDMVMI
DITDIPHVQEGDEVVLFGRELPVSQVAHWAQTIPYEMLTGISQRVKRVYFEE
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattatattgaagatattgctccaatcgttaaaggcacactgctacagcagcag
aagaatgtctttattgaacatctgttgacagatagccggaagttgatctttcctgctacc
tctttgttctttgccatcaaaggcccccggcgtgatggtcatggttttctggaggcgctg
tatgaaaagggggtgaggaattttgtggtgagtgatgtggtggaggtaaccaatataccg
gaggccaatatcatacaggtgaaggacgtgctgcaggctttgcaattactggcagcacat
caccgcaagcagttttctattccggtgatcggtattacgggcagcaatggtaaaacgatc
gtgaaagaatggctgaaccagctgctggatgatcaatacacgatcatccgcagcccacgc
agctacaactcacaaataggcgtgccgctgagtgtatggcccatgaatgaaacgcatgag
ctgggtatttttgaggccggcatctcgcaaagcggagagatggaacggctgcaaaagatc
attcagccaacgattggcatctttacgaatatcggagaggcgcatagtgaagggtttcta
aacctgcggcagaaggtgaatgagaagctgcggctgtttacgcatgtaaagacaatggtc
tattgtaaggatgcgccggagatcaatgagggggtagccacgctatggcagcaattcaac
aaaggcggcaaaggcagttttgatatattcaactggagtacggttacggaagctacgctg
caggtgctcaccatttataaggaaggtggtactaccctgatcacggccttgtacaaagag
caaacgattggtattacgatcccttttacggatgatgcttctgtggagaatgccattcat
tgctggtgtgtgctgttgcagctggaagtaaaaccccgcatcattgcgcaaaaaatgctg
caactggcaccagtggccatgcggctggaattgaagaagggggtcaacaattgttctatc
atcaatgacagttatagtgcggacctcagctctttcaatattgcgctggactttttgtcg
cagcagcggcagcatgtgagaaagacggtgatcctgtcggacatcctgcaaagcgggcgc
aatgaaaaggaattgtacaaggaagtggcgcaggcgctgtcgcagcgcggggtgagccgg
ttgatcggcattggtgaaaagatgatcctgcaccagggtattttccggctggcgcctatt
cctgaactggcgttttatccctcggtagaatcctttaaacatgattttcatcacctcgtt
tttcgcgatgagacgatcctgctgaaaggggcccgggtatttgaactggaacaaattgac
cggctgcttgaacaaaaggtgcatcaaacggtattggaaatagacctgaatgcattggcg
cataacctgcgtcaataccagcaattgctgaaacctgccactaaactgatggcgatggtg
aaagctttttcctatggcagcggcagctatgaaatagccaatgccttacaatttcataag
gtagattacctggcggtagcttatgcggatgaaggggtggaattgcgcaggggaggcatc
aacctgcccatcatggtgatgaatgcggatgaaacgacctttgatgtactggtgcaatat
aacctggaacccgatctgtattcgccgggtctcctgcaggcgtttgaagcattcctgaaa
ggggagggtatacgtcagtttccggtgcatattgagttggagacgggtatgaaccggtta
ggtttttcgccggcagaattgccggtattgctggaagcgctgaagggagatacgtttacg
gtgaaaagtgtattcagtcacctggcggccagtgaagaaaagcaacatgatgcctttacg
gagcagcaggcggctatatttcatacgatggtgaagcaattgcaggcggtgatcgcctat
ccgttcctgcggcatattgacaatacagcaggcattgcccggcatccggaccttcagttg
gatatggtgcggctgggtattgggctgtatggcattgacagcgggaatacgcataagctt
gaattgaaagaagtgtctacgcttattgccaccattgcccagatcaagcatttgaaagcg
ggggaaacggtgagttatggccgtaagggtgtagtgagccggaataccacggtagcgacg
gtacgtatcggttatgcagacgggtatccgcgcaacctcagtaatgggatcggtaaaatg
tgggtgaaaggaatgctggcgccggtaattggaacggtatgtatggatatggtaatgatt
gatattacggatattccgcatgtgcaggagggtgatgaggtggtgttgtttggaagggaa
ctgcctgtaagccaggtagcgcactgggcgcaaacgatcccttatgaaatgctgacgggt
atctcacagcgggtaaaaagggtgtattttgaggagtaa

DBGET integrated database retrieval system