KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_29095Help
Entry
D3H65_29095       CDS       T05640                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00620  Pyruvate metabolism
pseg00680  Methane metabolism
pseg01100  Metabolic pathways
pseg01120  Microbial metabolism in diverse environments
pseg01200  Carbon metabolism
Module
pseg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D3H65_29095
  09102 Energy metabolism
   00680 Methane metabolism
    D3H65_29095
Enzymes [BR:pseg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D3H65_29095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXY77796
UniProt: A0A3B7MXN7
LinkDB All DBs
Position
complement(7544870..7547449)
Genome map
AA seq 859 aa AA seqDB search
MDHQSTRGLQQFKNYVGIKFQLYNSLFTSLPFHRIEKTGILLSLLLNNCEEGYKHKQSPT
QIIEEFFEKHTIYQKDQDRCDLLFRFIQYVERQVVLFDALEDASFREVQDMNGIGTLKYL
ESEVIQEGAQDKLAEKLKDFSIRMVLTAHPTQFYPGTVLGIINDLSKALADNNASQINMY
LQQLGKTPFFKKQKPTPFDEAISLVWYLENVFYPAAGRIVSFLKNQFPQVVPDNNPIITM
GFWPGGDRDGNPFVTADTTLKVADLLRGSIIKCYYLDVRRLKRRLTFKGIDTILAELEKQ
LYNNIFIPGQRTALTKQGILDELYKIREILTYQHNGLFQHLVENLINKIQVFGLHFASLD
VRQESTVHNTVLEAIASKEKLLPENYASLSEQEKIKTLTSIRSTAHADLYEEGVIKDTLQ
SITAIKNIQEYNGPEGSNRYIISQCNSALNIMEVFGLFLLSGWTKDTLDIDIVPLFETID
DLEKAAGIMESLYKNDDYRQHLQRRNKRQTIMLGFSDGTKDGGYLMANWSIYKAKEELTS
ISRNYGFDVVFFDGRGGPPARGGGKTHKFYASMGNNISNKEIQLTIQGQTVSSNFGTVDS
AQFNIEQLLNAGISNHVFSAKEKTLQPEDEVLLKELADESLKAYTQLKNNPDFLNYLSHI
SPLKFYSETNIGSRPAKRGSSSKLSLKDLRAIPFVGAWSQLKQNVTGYYGVGMALQALDK
RGKLPAIKQLYKNSQFFKTLMDNCEMAMKKCFFPLTEYLSKDARYGEIWNLIFQEYELTK
KYIFQLSGNNELMFDYPVEQLSIQTRERIVLPLTTIQQYAMTRIRQLEEQQAPAAHKEIF
EKLVIRCSFGIINAGRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccagtcgacgagaggactgcagcaattcaagaattacgttggtatcaaattc
cagctttacaacagcctatttacttcgcttcccttccaccgcattgaaaagacaggtatc
ctgttatcgctgttattaaataattgtgaagaaggttataagcataagcaaagtcccacg
cagatcatcgaggagttctttgagaagcatacgatctatcagaaagaccaggaccggtgc
gacttgctgttccgctttatacaatatgtagaaaggcaggtagtgttgtttgacgcgctg
gaggatgcttctttccgggaggtgcaggacatgaacgggatcggtacgctgaagtacctt
gagtctgaagtgatccaggagggcgcgcaggacaagctggcagaaaaactgaaggacttt
tcgatccgcatggtgcttacagcgcaccctactcagttctaccctggcactgtgctgggc
attatcaatgacctttcgaaagcgctggcagacaataatgccagccagatcaatatgtac
ctgcagcagttgggcaaaacgccctttttcaaaaagcagaagcctacgcccttcgatgag
gcgatcagcctggtatggtacctggaaaacgtcttttacccggctgcaggcaggatcgtg
agctttttgaagaaccagttcccgcaagtggttcccgacaataatccgatcattacgatg
ggtttttggccgggtggtgaccgggatggcaatcctttcgtaacggcagatacgacgctt
aaagtagctgacctgcttcgtggcagcatcattaagtgctactacctggatgtacggcgc
ttaaaacgccgccttacgttcaaagggatcgatacgatactggcagagctggaaaagcag
ttgtacaataatatattcattccggggcagcgtacggcgcttacgaagcagggcatactg
gatgaattgtataagatcagggaaatcctgacctatcagcataatggtttgttccagcac
ctggtggaaaacctgatcaataagatacaggtattcgggcttcattttgcctcgctggat
gtaaggcaggaaagcacggtacacaatacggtactggaagctattgccagcaaggaaaag
ttattgccggaaaactatgcttcgctttcggagcaggaaaagatcaaaacgctgacgagc
atcaggagtacggcgcatgcagatctttatgaagaaggggtaatcaaggatacgctgcag
agcattacagctattaagaatatacaggaatataacggacctgaaggttcaaaccgctac
atcatcagtcagtgtaacagtgcactaaacatcatggaggtgtttggtctgttcctgttg
agtggctggacaaaagacacgctcgacattgatattgttcctctttttgaaacgatcgac
gacctggaaaaggcagcgggcattatggagtcgctgtacaagaatgatgattaccggcag
catcttcagcgccgcaataaacggcagacgatcatgctgggcttttcggacggcacgaaa
gacggtggttacctgatggccaactggagtatttacaaagccaaagaagagctgacgagc
atatcacgcaactatggttttgatgtggtgttctttgatggccgtggcggccctcctgca
cgcggcggcggcaagacgcataagttctatgcttcgatgggcaacaatatttccaacaaa
gagatacaacttacgatacaaggacaaacggtaagttcgaatttcggcacggttgattcg
gctcagttcaacattgagcaactgttaaatgcgggcatttcgaaccatgttttttctgcc
aaggaaaaaacgctgcagccggaagacgaagtgttgcttaaagaactggctgatgaaagc
ctgaaggcatatacgcaacttaaaaacaaccctgacttcctgaattacttatcgcatatc
agtccgctgaaattctatagtgaaacgaatatcggtagccggcctgcgaaaaggggcagc
tcttccaagctatctttgaaggacctccgtgccattccctttgtgggggcctggagccag
ctgaagcagaatgtgacgggttattatggggtgggcatggcgctgcaggctttggacaaa
agaggcaagcttcccgccattaaacagctttataaaaactcgcaattcttcaagacgctg
atggacaattgcgagatggcgatgaagaaatgtttcttcccgctgacggagtatctttcg
aaagatgcacggtatggagagatctggaatctgatcttccaggagtatgagctcacgaaa
aagtatatcttccaactgtcgggcaataatgaactgatgtttgattacccggtagagcaa
ctgtcaatacaaacacgtgaaaggatcgtattgccgctgacgactatccagcaatatgcg
atgacgcggatacggcaactggaagagcaacaggcgcctgctgcgcacaaagaaatcttt
gagaagttggtgatccgttgttcattcggcatcatcaatgccgggcggaattcggcttag

DBGET integrated database retrieval system