KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_30720Help
Entry
D3H65_30720       CDS       T05640                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00380  Tryptophan metabolism
pseg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D3H65_30720 (kynU)
Enzymes [BR:pseg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D3H65_30720 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AXY78101
UniProt: A0A3B7N8B6
LinkDB All DBs
Position
7976675..7977955
Genome map
AA seq 426 aa AA seqDB search
MENNLPYAQSLDAQDPLAPFRNEFLIPEHKGSQQIYFLGNSLGLQPRRTQARLQEVLNAW
AQYGVEGFFMGGQPWLQYHDTLTAPLATIVGALPHEVVVMNQLTVNLHLLMVSFYRPQGR
RRKIICEAKAFPSDQYMFETHVKHLGFHPEEVIIEVGPRVGEHTIRTEDILQAIDQHKDE
LALVLWGGINYYTGQLFDMSAIAKAAQAAGAKVGFDLAHAAGNVPLQLHQWNVDFACWCS
YKYLNSGPGAIGGVYIHERYHHDPEIHRFAGWWGYQKDTRFLMQKGFVPIPSAEGWQLST
PSLLLYAAHKAALEIVSEAGWDQLQQKRKKLNDWLWFLLEDLEKATGGAAIEFITPREET
ARGCQVSMLMLRDGKQLFDQLTAAGIMVDWREPNVIRLAPVPLYNTFEEVWRFVDTLKKL
IEQQVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaacaatctcccatacgcacaaagtctcgacgcccaagatcccctggcccccttc
aggaacgaattcctcatccctgaacacaagggcagtcagcagatctacttcctcggcaac
tccctcggtctccaaccccggcgcacccaggcccgcctccaggaggtattaaatgcctgg
gcccaatacggcgtagaaggttttttcatgggcgggcaaccctggctccaataccacgat
acccttaccgcaccactcgctaccatcgtaggcgccctgccccatgaagtggtggtgatg
aaccagctcaccgtcaacctccatttgctaatggtaagtttttaccggccccagggccgc
cgccgcaagatcatctgcgaggccaaagctttccccagcgaccagtacatgttcgagacc
cacgtaaagcacttgggtttccatcccgaagaagtgatcatagaagtaggtcccagggta
ggggagcacaccatcagaacagaagacatcctgcaggctatagatcagcacaaagacgag
ctcgccctcgtattatggggcggcatcaattattatacaggtcagttgttcgatatgtct
gccattgccaaagcagcccaggccgccggtgcaaaggtcggcttcgaccttgcccatgca
gccggcaatgtgcccctgcaattgcaccagtggaacgtcgactttgcctgctggtgcagt
tacaagtacttaaactcaggtcccggcgccattggcggcgtgtacatccatgagcgttac
caccacgatcccgagatacatcgttttgccggttggtggggataccaaaaagatacccgc
ttcctcatgcaaaaaggctttgtgcccatcccttctgccgaaggctggcaactcagcaca
ccttccctcttgttgtatgctgcccacaaagcagccctggaaatagtgagcgaagcaggg
tgggaccagctccagcaaaaaagaaaaaaactcaacgactggttatggttcctcctcgaa
gacctcgaaaaagccactggcggtgcagccattgagttcatcaccccgcgtgaagaaaca
gcccgcggctgccaggtgtccatgctcatgttgcgtgatggcaagcagctatttgaccag
ctcactgccgccggcatcatggtcgattggcgcgaacccaatgtcattcgcctcgccccc
gtacctttgtacaataccttcgaagaggtctggcgttttgtggataccttaaagaaatta
atagaacaacaggtaaagtaa

DBGET integrated database retrieval system