KEGG   Pseudonocardia sp. HH130629-09: XF36_02170Help
Entry
XF36_02170        CDS       T04082                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
pseh  Pseudonocardia sp. HH130629-09
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XF36_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C DUF1097
Motif
Other DBs
NCBI-ProteinID: ALE82086
UniProt: A0A0M4QCD2
LinkDB All DBs
Position
450283..451818
Genome map
AA seq 511 aa AA seqDB search
MTVTSRGGGMFRTKTVEQSIRDTDEPDTRLKKDLGTMDLIVFGVAVVIGAGIFTLAASTA
GNIAGPAVSLSFVLAAVACGLAALCYAEFASTVPVAGSAYTFSYATLGEFIAWIIGWDLV
LEFAVGSAYVSKGWSEYLAQTLGLLGIEVSTSFELGSFFSFDWGALLLVVVLAFLLYRGT
KLSSRVSLVITTIKVAIVLFVIILGAFFINAANYTPFVPEPTPGSVDTGTGIQQSLLSFF
GGASSSVFGVYGVFAAAAIVFFAFIGFDAVATTAEETKNPSKALPRGILGSLAIVTVLYV
AVALVITGMVPYTDLATKPDGTRATLATAFASLGINWAATIIAIGALLGLTTVVMVLMLG
QIRVIFAMSRDGLLPTALAKTNRFGTPGRATWLIGVVIALVATFFPAQDLEQMVNIGTLF
AFVLVSIGVVVLRRTRPDLPRGFRTPLVPLVPILAVLACVWLMLNLSVETWLRFIIWMVI
GVVVYFAYSRKNSILGRRERGDLPAQEPSSD
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcacgagccgtggtggcggcatgttccgcaccaagacggtcgagcaatccatc
cgggacaccgacgaaccggacacccggctgaaaaaggacctcgggacgatggacctgatc
gtcttcggggtcgcggtggtcatcggcgccggcatcttcaccctggccgccagcacggcc
ggcaacatcgcgggacccgcggtgtcgctgtcgttcgtgctggcggcggtcgcctgcggt
ctggccgcgctctgctacgcggagttcgcctcgacggtgccggtcgccggcagcgcctac
accttctcctacgccaccctgggcgagttcatcgcctggatcatcggctgggacctggtg
ctggagttcgcggtcggctcggcctacgtctcgaagggctggtcggagtacctggcccag
accctcggcctgctcggcatcgaggtgtcgacctcgttcgagctggggagcttcttctcc
ttcgactggggcgcgctgctgctcgtcgtcgtcctggcgttcctgctctaccgcggcacg
aagctgtccagccgggtcagcctggtgatcaccacgatcaaggtcgcgatcgtgctgttc
gtgatcatcctgggtgcgttcttcatcaacgcggcgaactacaccccgttcgtcccggag
cccacgcccggcagcgtcgacaccggcaccggcatccagcagtcgctgctgtcgttcttc
gggggcgcctcgtcgagcgtcttcggcgtctacggggtgttcgccgccgccgcgatcgtg
ttcttcgccttcatcggcttcgacgccgtcgccacgaccgcggaggagacgaagaacccg
tccaaggcgctgccgcgcggcatcctcggctcgctcgcgatcgtcaccgtgctctacgtc
gccgtcgcgctcgtgatcaccggcatggtgccctacaccgacctggccacgaagcccgac
ggcacccgcgccacgctggccaccgccttcgcctcgctgggcatcaactgggcggcgacg
atcatcgccatcggtgcgctgctcggtctcaccacggtcgtcatggtgctgatgctcggc
cagatccgcgtcatcttcgcgatgtcgcgcgacgggctgctgccgaccgcgctggcgaag
acgaaccgcttcggcaccccggggcgtgccacctggctgatcggcgtcgtcatcgccctg
gtcgcgacgttcttcccggcccaggacctcgagcagatggtcaacatcggcacgctgttc
gcgttcgtgctggtctcgatcggcgtggtggtcctgcgccggacccggccggacctgccg
cgcggcttccgcaccccgctggtgccgctcgtgccgatcctggccgtgctcgcctgcgtc
tggctgatgctgaacctgtcggtcgagacctggctgcggttcatcatctggatggtcatc
ggtgtggtcgtgtacttcgcctactcgcggaagaactcgatcctcggtcgtcgcgagcgc
ggcgacctgcccgcccaggagccgtcctcggactga

DBGET integrated database retrieval system