KEGG   Pseudonocardia sp. HH130629-09: XF36_03745Help
Entry
XF36_03745        CDS       T04082                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
pseh  Pseudonocardia sp. HH130629-09
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XF36_03745
Enzymes [BR:pseh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XF36_03745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ALE82359
UniProt: A0A0M3UAH4
LinkDB All DBs
Position
complement(775916..776323)
Genome map
AA seq 135 aa AA seqDB search
MRLSRILRPRLEATAHCDLPCGVYDPAQARIEAESVKAIQEKYQGNEDADFRARAIEIKE
QRSDLVKHHLWVLWTDYFKPPHFEKYPELHELFNKATKAAGASGTKGSNDPATGQELLDY
IAQIDKIFWETKQAA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcccgcattctccgtccgcgactggaggccaccgcgcactgcgacctcccc
tgcggcgtgtacgacccggcccaggcccggatcgaggccgagtcggtcaaggcgatccag
gagaagtaccagggcaacgaggacgcggacttccgggcccgcgccatcgagatcaaggag
cagcgctccgacctggtgaagcaccacctctgggtgctctggaccgactacttcaagccg
ccgcacttcgagaagtacccggagctgcacgagctgttcaacaaggccaccaaggccgcc
ggcgcgtcgggcaccaagggctcgaacgacccggccaccggccaggagctgctcgactac
atcgcccagatcgacaagatcttctgggagaccaagcaggctgcctga

DBGET integrated database retrieval system