KEGG   Pseudonocardia sp. HH130629-09: XF36_04190Help
Entry
XF36_04190        CDS       T04082                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh00564  Glycerophospholipid metabolism
pseh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XF36_04190
Enzymes [BR:pseh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XF36_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA AlaDh_PNT_C PrkA
Motif
Other DBs
NCBI-ProteinID: ALE82440
UniProt: A0A0M4QF65
LinkDB All DBs
Position
complement(878047..879759)
Genome map
AA seq 570 aa AA seqDB search
MKSVALSPETRTTALQAMGDRELDVLVVGGGVVGTGAALDAATRGLTTGLVEARDFASGT
SSRSSKLIHGGLRYLEMLDFRLVAEALQERGLLIQTLAPHLVRPVPFVYPLKHHVWERFY
AGAGVALYDSLGLLSGRARGLPHHRHLTRRGARKVVPSLRKDALVGALEYYDAQVDDARH
TMEIARTAAAYGAHVATRARVVGLLKDSGRVIGATVQDLESGDRFDVRAKEVINATGVWT
DDTQGLAGERGQFKVRASKGIHLVVPRDRIRGDAGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASAADIEYLLAHVNEVLEQPLTHEDVEGVYAGLRPLLHGESEATSKLSR
EHAVATPVPGLVVVAGGKYTTYRVMAKDAVDAAVHSLDAKVPASCTEKIPLLGAEGFTAL
RNSTHQLAARSGLHPVRIEHLLGRYGSLIDEVLDLLIADPTLAEPLTGAEDYLRAEVVYG
ASHEGARHLEDILARRTRISIETFDRGVGAAEETAKLVAPVLGWNDEQIAREVDHYVKRV
EAERESQKMPDDATADAARLGAPDVVPVVG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtggcgctctccccggagacccgtaccacggcgctgcaggcgatgggcgac
cgcgaactggacgtgctcgtcgtcggcggtggcgtcgtcggcacgggcgcagccctcgac
gcggccacccgcggtctgacgaccggactggtcgaggcccgcgacttcgcgtccggcacg
tcgagccgttcctccaagctcatccacggcggcctgcgctacctggagatgctcgacttc
cgcctggtggccgaggccctgcaggaacggggcctgctgatccagaccctcgcgccgcac
ctcgtccgcccggtgccgttcgtctacccgctcaagcaccacgtgtgggagcgcttctac
gccggtgccggcgtcgcgctctacgactcgctcgggctgctgtcgggccgggcccgcggc
ctgccgcaccaccggcacctgacccgtcgcggcgcccgcaaggtcgtgccgtcgctgcgc
aaggacgccctggtcggggccctggagtactacgacgcccaggtcgacgacgcccgccac
accatggagatcgcccgcaccgcggccgcctacggcgcgcacgtggcgacccgggcccgc
gtcgtcgggctgctgaaggactccggccgcgtgatcggcgcgaccgtgcaggacctggag
tccggcgaccggttcgacgtccgagccaaggaggtcatcaacgccaccggggtgtggacc
gacgacacccagggcctcgccggcgagcgcggccagttcaaggtgcgcgcgtccaagggc
atccacctggtcgtcccgcgggaccggatccgtggtgacgccgggctgatcctgcgcacc
gagaagtcggtgctgttcgtcatcccgtggggccggcactggatcatcggcaccaccgac
accgactgggacctggacaaggcgcacccggcggcgagcgcagccgacatcgagtacctg
ctcgcgcacgtcaacgaggtgctggagcagccgctgacccacgaggacgtcgagggcgtc
tacgccggtctgcgcccgctgctgcacggcgagtccgaggcgacctcgaagctgtcccgc
gagcacgccgtcgccaccccggtgcccgggctggtcgtcgtggccgggggcaagtacacg
acctatcgtgtgatggccaaggacgccgtcgacgcggccgtgcactcgctcgacgcgaag
gtgcccgcctcctgcaccgagaagatcccgctgctcggcgccgagggcttcaccgcgctg
cgcaactccacccaccagctggccgcgcgcagcggtctgcacccggtgcggatcgagcac
ctgctcggccggtacggctcgctgatcgacgaggtcctcgacctcctcatcgccgacccg
acactcgccgagccgctcaccggcgcggaggactacctgcgcgccgaggtcgtctacggc
gcctcgcacgagggcgcgcggcacctggaggacatcctggcccgccgcacccggatctcg
atcgagacgttcgaccggggcgtgggtgccgccgaggagaccgcgaagctggtcgccccg
gtcctgggctggaacgacgagcagatcgcccgcgaggtcgaccactacgtcaagcgggtc
gaggccgagcgggagagccagaagatgcccgacgacgccaccgccgacgccgcccgcctc
ggcgcgccggacgtggtcccggtcgtcggctga

DBGET integrated database retrieval system