KEGG   Pseudonocardia sp. HH130629-09: XF36_04195Help
Entry
XF36_04195        CDS       T04082                                 

Gene name
glpK
Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh00561  Glycerolipid metabolism
pseh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    XF36_04195 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseh04147]
    XF36_04195 (glpK)
Enzymes [BR:pseh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XF36_04195 (glpK)
Exosome [BR:pseh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XF36_04195 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: ALE82441
UniProt: A0A0M4Q8G6
LinkDB All DBs
Position
complement(879891..881408)
Genome map
AA seq 505 aa AA seqDB search
MAEFVGAVDQGTTSSRFMIFDHGGNEVGRHQLEHEQILPQAGWVEHDPIEIIERTNTCLQ
QALTKTGLTASDLVALGVTNQRETTVVWNRRTGRPYYNAIVWQDTRTDRIATALDRDGRG
DVIRRKAGLPPATYFSGGKIQWILENVDGVREAAENGDAVFGNTDTWGIWNLTGGANGGL
HVTDVTNASRTMLMDLETLDWDDELLGFFGIPRQMLPEIKPSSSATAFGKTLANGPLGGE
VPITGDLGDQQAATVGQVCFAPGEAKNTYGTGNFMLLNTGTELVRSESGLLTTMCYQFEG
ERPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVSDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVSDAMTKDSGVTLETLKVDGGVTQN
ELCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKNTDELRENWNEARRWEPAWS
QEQRDEGHGRWKKAVERTLDWVDVE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgtcggcgccgtcgaccagggcaccacctccagccgtttcatgatcttc
gatcacggcggcaacgaggtgggacgccaccagctggagcacgagcagatcctgccgcag
gccggctgggtcgagcacgacccgatcgagatcatcgagcgcaccaacacctgtctccag
caggcgctcaccaagaccggcctgaccgcgtccgacctggtcgcgctgggcgtcaccaac
cagcgtgagaccaccgtcgtgtggaaccggcgcaccgggcgcccgtactacaacgcgatc
gtctggcaggacacccgcaccgaccggatcgcgaccgcgctcgaccgcgacggccggggc
gacgtcatccgtcgcaaggcaggcctcccgcccgccacctacttctccggcggcaagatc
cagtggatcctggagaacgtcgacggcgtccgcgaggccgcggagaacggcgacgcggtc
ttcggcaacaccgacacctggggcatctggaacctcaccggtggcgcgaacggcggactg
cacgtcaccgacgtgaccaacgccagccggaccatgctgatggacctcgagaccctcgac
tgggacgacgagctgctcggcttcttcggcatcccgcggcagatgctgccggagatcaag
ccgtcgtcgtcggcgaccgcgttcggcaagaccctggcgaacggcccgctcggcggcgag
gtccccatcaccggtgacctcggcgaccagcaggcggcgaccgtcggccaggtctgcttc
gcccccggcgaggccaagaacacctacggcaccggcaacttcatgctgctcaacaccggc
accgagctggtccgctcggagtccggcctgctcaccacgatgtgctaccagttcgagggc
gaacgtccggtctacgcgctggagggctccatcgcggtcaccggctcggccgtgcagtgg
ctgcgcgaccagctcggcatcatctccggggcctcgcagtcggagtcgctggcccgccag
gtctccgacaacgggggcgtgtacttcgtgcccgcgttctccggcctgttcgcgccgtac
tggcgttccgacgcccgcggcgcgatcgtcggcctgtcccggttcaacaccaacgcgcac
ctggcccgggccacgctggaggcgatctgctaccagtcccgcgacgtcagcgacgccatg
acgaaggactccggggtgaccctggagacgctcaaggtcgacggcggcgtcacccagaac
gagctgtgcatgcagatccaggccgacgtgctgggcgtgccggtctcgcggccggtcgtc
gccgagaccaccgcgctcggtgcggcgtatgcggccgggctggccgtcgggttctggaag
aacaccgacgagctgcgggagaactggaacgaggcccggcgctgggagcccgcctggtcg
caggagcagcgcgacgagggccacggccgctggaagaaggccgtcgagcggaccctggac
tgggtcgacgtcgagtag

DBGET integrated database retrieval system