KEGG   Pseudonocardia sp. HH130629-09: XF36_07280Help
Entry
XF36_07280        CDS       T04082                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
pseh  Pseudonocardia sp. HH130629-09
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DUF3509
Motif
Other DBs
NCBI-ProteinID: ALE82979
UniProt: A0A0M3UAU8
LinkDB All DBs
Position
complement(1617134..1618198)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVKPMLAKPAPSIPDGRLYEPKWDGFRSIVFRDGDEVEIGSRNERPMTRYFPE
VVEAVREHFPPRAVVDGEIVVASGNALDFEALQQRIHPAVSRVTLLSTETPASFVAFDLL
ALGDDDLTARPFAERRALLEGAFAGVAPPVHLTPITDDTDTARRWFEKFEGAGLDGLIAK
DPAGTYQPDKRVMAKIKHERTADCVVAGYRVHKSGPDAVGSLLLGLHDARGVLVSVGVVG
AFPMARRRELMTELQPLVTDFDDHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLRPE
RVVEVRYDYMEGQRFRHTTQFVRWRPDRDPASCTYEQLERPVTFDLAEVLAGHG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctggccaagcccgccccgtccatc
cccgacggcaggctctacgaacccaagtgggacggcttccgctcgatcgtcttccgcgac
ggcgacgaggtcgagatcggctcccgcaacgagcggccgatgacccgctacttccccgag
gtcgtcgaggcggtgcgggagcacttcccgccgcgcgcggtggtcgacggggagatcgtc
gtcgcctcggggaacgcactggacttcgaggcgctccagcagcggatccaccccgcggtc
agccgggtgacgctgctctcgaccgagacgccggcgtcgttcgtcgccttcgacctgctg
gccctcggcgacgacgacctcaccgcacgcccgttcgccgagcgccgagcgctgctggag
ggggccttcgccggcgtcgccccgccggtgcacctcaccccgatcaccgacgacaccgac
accgcgcgccgctggttcgagaagttcgagggcgccgggctggacggcctcatcgccaag
gacccggccgggacctaccagcccgacaagcgcgtcatggccaagatcaagcacgagcgg
accgcggactgcgtcgtcgccgggtaccgggtgcacaagtccgggccggacgccgtcggg
tcgctgctgctgggcctgcacgacgcccgcggtgtgctggtgtcggtcggcgtcgtcggg
gcgttcccgatggcgcgccgccgcgagctcatgaccgagctgcagccgctggtcaccgac
ttcgacgaccacccgtgggcctgggcgaagcagctggagggcgagcgcaccccgcgcaag
tccgagacgagccggtggaacgccggcaaggacctgtccttcgtcccgctgcgcccggag
cgggtggtcgaggtccgctacgactacatggagggccagcggttccgccacaccacccag
ttcgtgcggtggcgcccggaccgcgaccccgcctcgtgcacctacgagcagctggagcgc
ccggtgaccttcgacctcgcggaggtcctcgccgggcacgggtga

DBGET integrated database retrieval system