KEGG   Pseudonocardia sp. HH130629-09: XF36_16195Help
Entry
XF36_16195        CDS       T04082                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
pseh  Pseudonocardia sp. HH130629-09
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALE84486
UniProt: A0A0M4QGZ9
LinkDB All DBs
Position
3560846..3562336
Genome map
AA seq 496 aa AA seqDB search
MSITSDTRAPLKALDRFFIGGEWVTPSSSSTISVIEPATEQVYYQVPEAQDADVDRAVTA
ARDAFDNGPWPTMGHARRAEFLRAIGEAVRERTADVVEVWPRESGIVLGAAQAMIGGVPD
AYAFYADLADTFAFEEPATPTAGGRYGMISREPVGVVGAIIPWNAPMTLIAYKLAPALLA
GCTVVLKASPEAPGAPYIMAEIAEKVGLPAGVLNVLTADREVSESLVRDPRVDKIAFTGS
TAAGRRIASILGERIGRYTLELGGKSAAVILDDMDLAEAAASLSGAECFLSGQVCSSLTR
IVVPRRRHDEMADALAGTFSQVRVGDPFDANTQMGPLAMERQRDRVEGFIAQGKAEGARL
VTGGGRPQGLDRGWFIEPTVFAGVDNSWSIAQEEIFGPVLSVIPAEDEEDAIRIANDTIY
GLNAAVFTHDADRAREVAGRLRAGTVGHNNFRTDFGIGFGGFKQSGTGREGGVDGLLPYL
ENKTIIFEEKPGNFPG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccagtgacacccgggcaccgctcaaggcgctcgacaggttcttcatcggc
ggcgagtgggtcaccccgtcctcgtccagcacgatctcggtgatcgagcccgccaccgaa
caggtctactaccaggtcccggaggcccaggacgccgacgtcgaccgggccgtcacggca
gcccgcgacgcgttcgacaacggcccctggccgacgatgggtcatgcccggcgcgcggag
ttcctgcgcgccatcggcgaggccgtgcgggagcgcaccgccgacgtcgtcgaggtctgg
ccgcgcgagtccggcatcgtcctgggcgcggcccaggccatgatcggcggcgtcccggac
gcgtacgcgttctacgccgacctggccgacaccttcgcgttcgaggagccggcgacgccg
accgcgggcggccggtacgggatgatctcccgcgagccggtcggggtcgtcggcgcgatc
atcccgtggaacgcgcccatgacgctgatcgcctacaagctggcaccggcactgctcgcc
ggctgcacggtggtgctcaaggcctcgcccgaggcgccgggcgcgccgtacatcatggcc
gagatcgcggagaaggtcggcctgcccgccggcgtcctcaacgtcctcaccgccgaccgc
gaggtctccgagtcgctggtccgcgacccgcgggtcgacaagatcgccttcaccggctcc
accgcggcgggacgccggatcgcctcgatcctgggcgagcgcatcggccgctacaccctc
gagctcggtggcaagtccgcggcggtcatcctcgacgacatggacctcgccgaggccgcg
gcgagcctgtccggcgccgagtgcttcctgtcgggccaggtctgctcgtcgctgacccgc
atcgtcgtaccgcgacgacggcacgacgagatggccgacgccctggccgggacgttctcc
caggtccgcgtcggcgacccgttcgacgcgaacacccagatgggcccgctggccatggag
cgccagcgcgaccgggtcgagggcttcatcgcccagggcaaggccgagggtgcgcgcctg
gtgaccggcgggggccgcccgcagggcctcgaccggggctggttcatcgagccgacggtg
ttcgccggggtcgacaactcctggtccatcgcccaggaggagatcttcggtccggtcctg
tcggtgatcccggccgaggacgaggaggacgcgatccggatcgccaacgacacgatctac
gggctgaacgccgcggtgttcacccacgacgccgaccgcgcgcgggaggtggccggccgc
ctgcgggcggggacggtcgggcacaacaacttccggacggacttcggtatcggcttcggc
gggttcaagcagtccgggacgggccgggagggcggcgtcgacggcctgctgccgtacctg
gagaacaagacgattatcttcgaggagaagccggggaacttcccgggctga

DBGET integrated database retrieval system