KEGG   Pseudonocardia sp. HH130629-09: XF36_18830Help
Entry
XF36_18830        CDS       T04082                                 

Definition
(GenBank) 3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh00260  Glycine, serine and threonine metabolism
pseh00270  Cysteine and methionine metabolism
pseh00680  Methane metabolism
pseh01100  Metabolic pathways
pseh01120  Microbial metabolism in diverse environments
pseh01130  Biosynthesis of antibiotics
pseh01200  Carbon metabolism
pseh01230  Biosynthesis of amino acids
Module
pseh_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    XF36_18830
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XF36_18830
   00270 Cysteine and methionine metabolism
    XF36_18830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseh04147]
    XF36_18830
Enzymes [BR:pseh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     XF36_18830
    1.1.1.399  2-oxoglutarate reductase
     XF36_18830
Exosome [BR:pseh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XF36_18830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 AdoHcyase_NAD IlvN F420_oxidored ACT_4 Shikimate_DH UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ALE84935
UniProt: A0A0M3UBU9
LinkDB All DBs
Position
complement(4114337..4115947)
Genome map
AA seq 536 aa AA seqDB search
MSTAATDHRPVVLLAETLAPSAVELLGDGVEIRRVEGTDRPALLAALADADALLVRSATR
VDAEALAAAGRLKVVARAGVGLDNVDVPAATARGVMVVNAPTSNIVSAAEHAIALLLATA
RHIPAADAALRSGEWRRSAYGGVELGGKTVGIVGLGKIGQLVAQRLAAFGTTLVAYDPYI
APSRAAQLGIELLSLDDLLRTADMITVHLPKTPETLGLIGKDQLALTKPGVLLVNAARGG
LIDEDALAEAVRSGHVAGAGIDVYVTEPTTSSPLFELENVVVTPHLGASTTEAQDRAGTD
VARSVQLALAGEFVPDAVNVQIHGAVGEEVRPWLPLVQKLGTTLHAVAGRTPTSVTVDVA
GELASEDVQVLGLAALRGVFTHVVEDQVTFVNVPQLAEERGVAVEITTSPESANHRSVVQ
LRGAMPDGEKVTVSGTLTGRAEVEKLVEINGRHFDLRAEGEVVLLEYADRPGVMGRVGSL
LGEAAVNIEAAQISQTTDGTDAIMLLRVDRQIDPAVLEPVGASVGARTIRLISFDD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgcagccaccgaccaccgtcccgtcgtcctgctcgcggagactctcgcgccc
tccgccgtcgagctgctcggtgacggcgtcgagatccgccgcgtcgaaggcaccgaccgt
ccggccctgctggcggcactcgccgacgccgacgcgctcctggtccggtccgccacccgg
gtcgacgccgaggcgctggccgcggccggccgtctgaaggtcgtcgcgcgggccggggtc
ggcctggacaacgtggacgtccccgccgccaccgcgcgcggggtgatggtcgtcaacgcc
ccgacctccaacatcgtctccgccgccgagcacgccatcgcgctgctgctggcgaccgcg
cgccacatcccggcggcggacgccgcgctgcggtccggtgagtggcggcgctcggcctac
ggcggtgtcgaactgggcggcaagaccgtcggcatcgtcggtctcggcaagatcgggcag
ctcgtcgcacagcgcctcgccgcgttcggcacgacgctggtcgcctacgacccctacatc
gcgccgtcgcgcgccgcccagctcggcatcgagctgctgagcctcgacgacctgctccgc
accgcggacatgatcacggtgcacctgccgaagaccccggagacgctcgggctcatcggt
aaggaccagctcgcgctcaccaagcccggggtgctcctcgtcaacgccgcccgcggtggc
ctgatcgacgaggacgccctggccgaggcggtccgctccgggcacgtcgctggcgccggg
atcgacgtctacgtcaccgagccgaccacgtccagcccgctgttcgagctggagaacgtc
gtcgtcaccccgcacctgggtgcctccaccaccgaggcgcaggaccgggccgggaccgac
gtggcccgctcggtgcagctggcgctggccggggagttcgtgccggacgcggtcaacgtg
cagatccacggcgccgtcggcgaggaggtccggccctggctgccgctggtgcagaagctg
ggcaccacgctgcacgccgtcgccgggcggaccccgacctcggtcaccgtcgacgtcgcg
ggcgagctggccagcgaggacgtccaggtcctcgggctggccgcgctgcgcggggtgttc
acccacgtcgtcgaggaccaggtgaccttcgtgaacgtgccgcagctcgccgaggagcgc
ggggtcgccgtggagatcaccaccagtccggagagcgccaaccaccgcagtgtggtgcag
ctgcgcggcgccatgcccgacggcgagaaggtcaccgtgtccggcaccctgaccggccgc
gcggaggtcgagaagctcgtcgagatcaacggacggcacttcgacctgcgcgccgagggc
gaggtcgtgctgctggagtacgccgaccgtcccggcgtgatgggccgggtcgggtcgctg
ctgggggaggccgcggtcaacatcgaggccgcccagatctcgcagaccaccgacggcacc
gacgccatcatgctgctgcgggtggaccgccagatcgacccggcggtgctggagccggtc
ggtgcctcggtcggcgcccggacgatccggctgatctccttcgacgactga

DBGET integrated database retrieval system