KEGG   Pseudonocardia sp. HH130629-09: XF36_20200Help
Entry
XF36_20200        CDS       T04082                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh00250  Alanine, aspartate and glutamate metabolism
pseh00410  beta-Alanine metabolism
pseh00640  Propanoate metabolism
pseh00650  Butanoate metabolism
pseh01100  Metabolic pathways
pseh01120  Microbial metabolism in diverse environments
Module
pseh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XF36_20200
   00650 Butanoate metabolism
    XF36_20200
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XF36_20200
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XF36_20200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pseh01007]
    XF36_20200
Enzymes [BR:pseh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XF36_20200
Amino acid related enzymes [BR:pseh01007]
 Aminotransferase (transaminase)
  Class III
   XF36_20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALE85179
UniProt: A0A0M3UC72
LinkDB All DBs
Position
complement(4408255..4409511)
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLYDTDGRRHLDFTAGIGVTSTGHCHPRVVAAAQEQVA
TLIHGQYTTVMHQPLLALVERMGEVLPEGIDSVFFTNSGSEAVEASVRLARQATGRQLIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFAPFPYAYRYGWSEEQAVAFALSEL
DRQLASTAPASDVAAFIVEPVLGEGGYVPTPPAFLQGLRERADRHGILLIADEVQTGYGR
TGKFWGHQHAEGLVPDIIVTAKGLASGFPLSAIAAPKALMAQALPGSQGGTYGGNAVACA
AALATLEVVQGEGLVENSRVQGEKLLAGVRDAAQGIAAIGDVRGRGLMIGIEFVDADGKP
DGATAAKVHAAAAAQGLLLLTCGVYGNVVRMIPALVVTSEQVDEGLALWTKALNDALS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctcaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctacctgtacgacaccgatgggcgccgccacctcgacttcaccgccggcatcggc
gtcacctccaccgggcactgccacccgagggtcgtcgcggcggcgcaggagcaggtggcc
acgctgatccacggtcagtacacgaccgtgatgcaccagccactgctggcgctggtcgag
cggatgggcgaggtgctccccgagggcatcgactcggtgttcttcaccaactccggttcc
gaggccgtcgaggcgtcggtgcggctggcccgccaggccaccggccggcagctgatcgtc
gcgttcgacggcggcttccacggccgcaccatgggtgccgcggcgctcaccacctccggg
gcgaagatccgggccgggatcggcccgatgatgggtggggtcgcgttcgcacccttcccc
tacgcctaccgctacggctggtccgaggagcaggccgtcgcgttcgccctgtccgagctc
gaccgccagctggcgagcaccgcgccggcgtccgacgtcgccgcgttcatcgtcgaaccg
gtgctcggcgagggcggctacgtcccgaccccgcccgcgttcctccagggcctgcgcgag
cgcgccgaccggcacggcatcctgctgatcgccgacgaggtccagaccggctacggccgc
accgggaagttctggggccaccagcacgccgagggtctcgtcccggacatcatcgtcacc
gccaaggggctcgcgtccggcttcccgctctcggccatcgccgcgcccaaggcgctcatg
gctcaggccttgcccggctcgcagggcggcacctacggcggcaacgccgtcgcctgcgcc
gccgcactcgcgaccctcgaggtcgtgcagggcgaggggctggtcgagaactcccgggtg
cagggcgagaagctcctcgccggggtccgggacgccgcgcaggggatcgccgccatcggc
gacgtccgcggccgcggactcatgatcggcatcgagttcgtcgacgcggacggcaagccc
gacggcgccaccgccgcgaaggtgcacgccgcggccgccgcgcaggggctgctgctgctg
acctgcggtgtgtacggcaacgtcgtccggatgatcccggcgctggtcgtgacctcagag
caggtcgacgagggcctggcgctctggaccaaggcgctgaacgacgcgctgtcctga

DBGET integrated database retrieval system