KEGG   Pseudonocardia sp. HH130629-09: XF36_23625Help
Entry
XF36_23625        CDS       T04082                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    XF36_23625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pseh03400]
    XF36_23625
Enzymes [BR:pseh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XF36_23625
DNA repair and recombination proteins [BR:pseh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XF36_23625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALE85765
UniProt: A0A0M3UC91
LinkDB All DBs
Position
complement(5102070..5102984)
Genome map
AA seq 304 aa AA seqDB search
MLATPGPLPTGAGWSFEVKWDGMRVLAEVTDGGGEPALRLRTRSGRDVTANFPELAGLVD
LAPDVLLDGEVVLLDGGVPSFAALAHRIHGPAGGRPVTFMVFDVLRLYGVPLLDRPLSER
RATLERLDLAATPHVEASPLYPDGAALLEVTASRGLEGVVAKREDSRYRPGRRSPHWVKI
AHRQSQSCVVGGWKPERGGGGGRVGALLLGVPGPDGLEFAGRVGSGLAGAAVQDLLAARL
TEVPESPFARLPPRADAADARWCSPTVVVEVAHLGWTAAGRLRQPVFRGIRDDVEAVDVR
REPG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccacccccggacccctcccgaccggcgccggttggtcgttcgaggtcaagtgg
gacggcatgcgcgtgctggccgaggtcaccgatggcggtggcgagccggcactgcgtctg
cgtacccgttccggccgcgatgtcaccgcgaacttccccgagctcgccggtctggtggac
ctcgcccccgacgtgctcctcgacggcgaggtggtactgctcgacggcggtgtccccagc
ttcgccgcgctggcccaccggatccacggtcccgcgggcgggcgtccggtcaccttcatg
gtgttcgacgtgctgcgcctgtacggggtgccgctgctcgaccgcccgctgtccgagcgc
cgggccaccctggagcggctcgacctcgccgctaccccgcacgtcgaggcgtccccgctc
tacccggacggggccgccctgctggaggtgacggcgtcgcgcgggctggagggtgtcgtc
gccaagcgggaggactcgcggtaccggccgggccggcgcagcccgcactgggtgaagatc
gcccaccggcagtcgcagtcctgtgtggtgggcgggtggaagcccgagcgcggcggcggt
ggcggtcgggtcggggcgctgctgctcggtgtccccggcccggacggtctggagttcgcc
ggccgggtcgggtccgggctggccggggcggcggtgcaggacctgctcgccgcccggctg
accgaggtgccggagtcgccgttcgcgcggctcccgccccgggccgacgccgcggacgca
cgctggtgctccccgacggtcgtcgtcgaggtcgcccacctcgggtggacggcggcgggc
cggctgcggcagccggtgttccgcgggatccgcgacgacgtcgaggccgtcgacgtgcgc
cgggagccgggctga

DBGET integrated database retrieval system