KEGG   Pseudactinotalea sp. HY158: GCE65_13520
Entry
GCE65_13520       CDS       T06271                                 

Definition
(GenBank) type I pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
psei  Pseudactinotalea sp. HY158
Pathway
psei00770  Pantothenate and CoA biosynthesis
psei01100  Metabolic pathways
psei01240  Biosynthesis of cofactors
Module
psei_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:psei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    GCE65_13520
Enzymes [BR:psei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     GCE65_13520
SSDB
Motif
Pfam: PRK CoaE AAA_18
Other DBs
NCBI-ProteinID: QGH70395
UniProt: A0A5Q2W302
LinkDB
Position
3089453..3090406
AA seq 317 aa
MSIPDVELNSPFAEFDRATWRALASSTPLPLTQADVENLAGLGDPIDLHEVDTVYRPLSR
LLNLYVAASQQLRQATSTFLGDWTRHTPFVIGVAGSVAVGKSTTSRLLRELLRRWPETPR
VQLITTDGFLYPNAELERRGLMERKGFPESFDRRRLIEFLEDVKGGSEAVAAPVYSHLAY
DIIPDAQIVVRKPEVLIVEGLNVLAPARVHPDGHAGLAVSDFFDFSIYVDAETAHIRRWY
VERFLRLRRTAFADPDSYFHRYASLDDDAAVARAQQIWDDINEPNLVENVLPTRARATLV
LSKDTDHRVSRLRLRQI
NT seq 954 nt   +upstreamnt  +downstreamnt
gtgtccatccccgacgtggagctcaactccccgttcgccgagttcgaccgcgccacgtgg
cgcgcgctcgcgtcctcgaccccgcttccgctgacgcaggcggacgtcgagaacctggcc
gggctgggcgatccgatcgacctgcacgaagtggacaccgtctaccggccgctgtcgcgc
ctgctcaacctgtacgtggccgcctcacagcaactgcggcaggccacctcgacgttcctc
ggcgattggacccggcacaccccgttcgtcatcggggtcgccggctccgtggccgtcggc
aagtcgaccacctcccggctgctgcgggaactgcttcgccgctggcccgagacgccgcgg
gtgcagctcatcaccaccgacggcttcctctacccgaacgccgagctggagcggcgcggg
ctgatggagcgcaagggcttcccggaatccttcgaccggcgccgcctcatcgagttcctc
gaggacgtcaaaggcggctcggaggcggtcgcggctccggtgtactcacacctggcctac
gacatcatcccggacgcgcagatcgtggtgcgcaagccggaggtactcatcgtcgagggc
ctcaacgtgctcgcgccggcacgcgtccacccggacggccacgccggcctggccgtgagc
gacttcttcgacttctccatctacgtcgacgccgaaacggcccacatacgccgctggtac
gtcgaacgtttcctacggctgcggcgcaccgccttcgccgacccggactcctatttccac
cgatacgcgagcctggacgacgacgccgccgtcgcccgcgcgcagcagatctgggacgac
atcaacgagccgaacctggtcgagaacgtgctgcccacccgggcccgagccacgctcgtg
ctctccaaggacaccgaccaccgggtctcccggctccgactgcgtcagatctga

DBGET integrated database retrieval system