KEGG   Pseudactinotalea sp. HY158: GCE65_15955
Entry
GCE65_15955       CDS       T06271                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psei  Pseudactinotalea sp. HY158
Pathway
psei00250  Alanine, aspartate and glutamate metabolism
psei00410  beta-Alanine metabolism
psei00640  Propanoate metabolism
psei00650  Butanoate metabolism
psei01100  Metabolic pathways
psei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GCE65_15955
   00650 Butanoate metabolism
    GCE65_15955
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GCE65_15955
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GCE65_15955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psei01007]
    GCE65_15955
Enzymes [BR:psei01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GCE65_15955
Amino acid related enzymes [BR:psei01007]
 Aminotransferase (transaminase)
  Class III
   GCE65_15955
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: QGH70819
UniProt: A0A5Q2W483
LinkDB
Position
3616922..3618181
AA seq 419 aa
MTALSPRLLQATPVTVDHGAGSYLFDVDGRRYLDFTAGIGVTSTGHCHPHVVEAARAQVG
SLIHGQYTTVMHRPLLELTEKLGEVLPPGLDSLFFANSGSEAVEAALRLARQATGRPNVI
VFHGGFHGRTVATASMTTSGTRFSAGFSPLMAGVHVAPFPTAYRYGWSEEEATDFALREL
DYLFATLTAPAETAAFVVEPVLGEGGYIPGNTRFFAGLRERADEHGILLVIDEIQTGFGR
TGRYFGHEHFDVRPDVITIAKGLASGFPLSGIAAPGELMAKAWPGSQGGTYGGNAVACAA
AVATLDVIREEGLVANAAERGTQLLAGCRDLAPRATNDAGSIGDVRGLGLLVASEFVTSD
GRPDSARAAAAQQAAARSGLLLLTCGAYMNCVRMIPPLIVTAEQIDEGLAIWADVLAAI
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgactgcgctctcgccccggctgctccaagccacgcccgtgacggtggatcacggcgcg
ggaagctacctgttcgacgtcgacggccgccgctacctcgacttcaccgccggcatcggg
gtgacgagcaccggccactgccacccgcacgtggtcgaggccgcgcgcgcccaggtcggc
tctctcatccacggccagtacaccaccgtgatgcaccgcccgctactggagttgaccgag
aagctcggcgaggtgctcccccccggactcgattccctcttcttcgccaactccggcagc
gaggcggtcgaggcggccctgcggctcgcccgccaggccaccggccgcccgaacgtcatc
gtgttccacggcggcttccacgggcgcacggtcgcgaccgcctcgatgacgacctcgggc
acccggttctcggcaggattcagcccgctcatggccggagtgcacgtggcacccttcccg
accgcgtaccgctacggctggagcgaggaggaggcgaccgacttcgcgctgcgcgagctc
gactacctcttcgccaccctcaccgccccggcggagaccgcggcgttcgtcgtggagccc
gtgctgggcgagggcggctacatcccgggcaacacccgattcttcgcgggcctgcgggaa
cgcgcggacgagcacgggatcctgctcgtgatcgacgagatccagaccggcttcgggcgc
acgggccgctacttcggtcacgaacacttcgacgtgcgccccgacgtcatcacgatcgcc
aaggggctcgcctcgggattcccgctctcgggcatcgcggcgccgggcgagctcatggcg
aaggcctggcccggttcgcagggcggcacctacgggggcaacgccgtggcctgcgccgcc
gccgtggccacgctcgacgtgatccgggaggaggggctcgtggccaatgccgccgagcgc
ggcacgcagctgctcgccgggtgccgagacctcgcgccgcgggcgacgaacgacgcgggt
tccatcggggacgtgcgcgggctcgggctgctcgtggcgagcgaattcgtgacctccgac
ggccggccggactccgcccgcgccgccgccgcgcagcaggccgccgcccgatccgggctc
ctcctgctcacctgcggggcgtacatgaactgcgtgcggatgatcccgccgctgatcgtc
acggccgagcagatcgacgagggcctggcgatctgggccgacgtgctcgccgcgatctga

DBGET integrated database retrieval system