KEGG   Pseudodesulfovibrio sp. SRB007: GM415_09695
Entry
GM415_09695       CDS       T06353                                 

Definition
(GenBank) PAS domain-containing protein
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
psel  Pseudodesulfovibrio sp. SRB007
Brite
KEGG Orthology (KO) [BR:psel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psel01001]
    GM415_09695
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psel02022]
    GM415_09695
Enzymes [BR:psel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GM415_09695
Protein kinases [BR:psel01001]
 Histidine kinases
  NtrC family
   GM415_09695
Two-component system [BR:psel02022]
 NtrC family
  Unclassified
   GM415_09695
SSDB
Motif
Pfam: HATPase_c HisKA PAS_9 PAS_4 HATPase_c_5 PAS PAS_8
Other DBs
NCBI-ProteinID: QGY40390
LinkDB
Position
complement(2173768..2174967)
AA seq 399 aa
MAPSTTLSDLIGIEHSKLGFFQELQHTIEELQAANEESESQRREIAAILDGITDVMMVLS
ENLRIISVNHAFREIFDSVEPEGKYCYELFRNSVEPCPECPAFRSLSTNKVCKELAFFRI
NGRKRQFEMIASPLKGPYGSGNRVLIFKRDVTLEKEYQAKYYQAEKMATVGTLATGVAHE
VNNPLMAISGYAEGIQRKLTKLTAECIPAEVKTDFEDYTNTILKECHRCQQIVKSLLNFG
HPETSVFGIVNLNDVIKDTLNILGYHLKRSKELSLELDLADELPLIYADEPRLKQVMLNL
MTNAADALQGKEGVISLHTRMNGKGAVVLEVADNGCGISPEIKDRLFDPFFTTKPVGKGI
GIGLSTCYNIVKDHHGEISVLSEEGVGSRFVVTLPIQQD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcaccgtccaccaccctaagcgacctgatcggcatcgagcactccaagctcggcttc
ttccaggagctgcaacacaccattgaggagctccaggcggccaacgaggagtccgagagc
cagcgccgagagatcgcggccatcctggacggcatcaccgacgtgatgatggtcctctcc
gagaacctgcgcatcatctccgtcaaccacgccttccgcgaaatcttcgacagcgttgag
cccgaaggcaagtactgctacgagctgttccgcaactccgtggaaccctgccccgagtgt
ccggcctttcgctccctgtccaccaacaaggtctgcaaggagctggcgttcttccgcatc
aacggcagaaagagacagttcgagatgatcgcctcgcccctgaagggcccctacggctcg
gggaaccgcgtgctcatcttcaagcgcgacgtgaccctggaaaaggaatatcaggccaag
tactaccaggcggaaaagatggccaccgtcggtaccctggccacgggcgtggcccatgaa
gtgaacaacccgctcatggcgatctccggctatgccgagggcatccagcgcaagctcacc
aagctcaccgccgagtgcatccccgccgaggtcaaaaccgacttcgaggactacaccaac
acgattctcaaggagtgccaccgctgtcagcagatcgtaaagagcctgctcaacttcggc
catcccgaaacctcggtattcggcatcgtcaacctcaacgacgtgatcaaggataccctc
aacatcctcggctaccatctcaagcgctccaaggagctctccctggaactggacctggcc
gacgaactgcccctgatctacgccgacgaaccccggctcaagcaggtcatgctcaacctg
atgaccaacgccgccgacgccctccagggaaaggagggagtcatctccctgcacacacgg
atgaacggaaagggcgccgtggttctggaggtggctgacaacggctgcggcatttccccg
gaaatcaaggacagactcttcgaccccttcttcaccacgaaacccgtgggcaagggcatc
ggcatcggcctgtcaacatgctacaacatcgtcaaggatcaccacggcgagatcagcgtc
ctcagtgaagagggcgtaggctcccgcttcgtcgtcaccttgccgatccaacaggactga

DBGET integrated database retrieval system