KEGG   Pseudomonas sp. MRSN12121: TO66_08540Help
Entry
TO66_08540        CDS       T03702                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00020  Citrate cycle (TCA cycle)
psem00190  Oxidative phosphorylation
psem00650  Butanoate metabolism
psem01100  Metabolic pathways
psem01110  Biosynthesis of secondary metabolites
psem01120  Microbial metabolism in diverse environments
psem01130  Biosynthesis of antibiotics
psem01200  Carbon metabolism
Module
psem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psem_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TO66_08540 (sdhA)
   00650 Butanoate metabolism
    TO66_08540 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TO66_08540 (sdhA)
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TO66_08540 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     TO66_08540 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 FAD_oxidored DUF2087
Motif
Other DBs
NCBI-ProteinID: AJO77347
UniProt: A0A0C5EH77
LinkDB All DBs
Position
1879238..1881010
Genome map
AA seq 590 aa AA seqDB search
MANIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVITKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVFELDHMGLPFSRTEQGRIYQRP
FGGQSKDYGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTTFLNEYYAVDLVKNQDGAF
VGVIAICIETGETTYIRAKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGCGPNGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GVATNIHGQAITQNAEGVDEIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALTDGIEYDDATEADINAALARLNALNERTDGEDVATLRRELQSCMQNYFGVFRTGE
YMQKGIAQLAELRTRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFEDRDDENWLCHTLYFPGEKRVAKRAVNFSPKTVPTFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaacattccaacgatttctttcgacgccatcatcattggcggcggcggcgccggc
atgcgtgccgcactgcagctggcccagggcggccacaagactgcggtgatcaccaaggtg
ttcccgacccgttcgcacactgtgtcggcccagggcggcatcacctgcgccatcgcgtcg
gccgacccgaacgatgactggcgctggcacatgtacgataccgtcaagggttccgactac
atcggtgaccaggacgctatcgaatacatgtgtcaggaaggcccggccgcggttttcgag
ctggaccacatgggtctgccgttctcccgtaccgaacaaggccgtatctaccagcgtcct
ttcggcggtcagtccaaggattacggcaagggtggccaggctgcccgtacctgtgccgct
tccgaccgtaccggtcacgcgctgctgcacactctttatcagggcaacctgaaagccggc
accaccttcctgaacgagtactacgccgttgacctggtgaagaaccaggacggcgcgttc
gtcggtgtgatcgcgatctgcatcgaaaccggtgaaaccacctacatccgcgcgaaagcc
accgtgctggctaccggcggtgcaggtcgtatctacgcttccaccaccaatgccctgatc
aacaccggcgacggtgtcggcatggcgctgcgtgccggcgtaccggtacaagacattgaa
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggttaccgaaggttgc
cgtggtgaaggtggttacctgatcaacaagcacggcgaacgtttcatggaacgttacgct
ccgaacgccaaggaccttgccggtcgtgacgttgttgcccgttcgatggtcaaggaaatc
attgccggcaacggttgcggtccgaatggcgaccacgtgatgctcaagctcgaccacctg
ggcgaggaagtgctgcacagccgtcttccaggcatctgcgaactgtccaagacgttcgct
cacgttgacccggtggttgctccggttccggttgtaccgacttgccactatatgatgggc
ggcgttgccaccaatattcatggccaggcgatcacccagaacgccgaaggcgtggacgaa
atcatccctggtctgttcgccgtgggcgaagtggcttgcgtatcggtgcacggtgccaac
cgtctgggtggcaactcgttgctcgacctggtggtcttcggtcgcgctgccggcctgcac
ctggaaaaagccctgaccgacggtatcgaatatgacgacgctaccgaggccgacatcaac
gcggccctggcacgtctgaacgctctgaacgagcgtaccgatggcgaagacgtggcaacc
ctgcgtcgcgagctgcagagctgcatgcagaactacttcggtgtattccgtactggcgaa
tacatgcagaagggcattgcccagctggccgagctgcgtacccgcatcgccaacgtcaag
atcaacgacaagtcgcaggcgttcaacactgcgcgtatcgaagcgctggaactgcagaac
ctgctggaagtggccgaagccaccgccatcgctgccgaagtgcgcaaagagtcccgcggt
gctcatgcccgtgaagacttcgaagaccgcgacgacgaaaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgttgccaagcgtgccgttaacttctcgccgaagactgtt
ccgactttcgagccaaaagtccggacttactaa

DBGET integrated database retrieval system