KEGG   Pseudomonas sp. MRSN12121: TO66_08545Help
Entry
TO66_08545        CDS       T03702                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00020  Citrate cycle (TCA cycle)
psem00190  Oxidative phosphorylation
psem00650  Butanoate metabolism
psem01100  Metabolic pathways
psem01110  Biosynthesis of secondary metabolites
psem01120  Microbial metabolism in diverse environments
psem01130  Biosynthesis of antibiotics
psem01200  Carbon metabolism
Module
psem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psem_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TO66_08545 (sdhB)
   00650 Butanoate metabolism
    TO66_08545 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TO66_08545 (sdhB)
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TO66_08545 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     TO66_08545 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AJO77348
UniProt: A0A0C5DTX8
LinkDB All DBs
Position
1881023..1881727
Genome map
AA seq 234 aa AA seqDB search
MLQVEVYRYNPDTDAAPKTQVFQVDTGGKDLMVLDVLALIKEQDEGFSYRRSCREGVCGS
DGMNINGKNGLACITPLSSVVKNNKLVIRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEERDKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTSERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHIRNMLLSSGV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagttgaagtttatcgttacaaccctgacaccgacgctgcgccgaaaacccag
gttttccaggtcgacaccggtggcaaggatctgatggtgctggacgtgctggcgctgatc
aaggagcaggacgagggtttctcctaccgtcgctcctgccgtgaaggcgtttgtggttcc
gatggcatgaacatcaacggcaagaacggcctggcttgcatcacgccgctgtcctccgtg
gtgaagaacaacaagctggtcattcgtccgttgccaggtttgccggttatccgtgacctg
gtcgtcgatatgagcatcttctacaagcaatacgagaaggtgaagccattcctgcagaac
gacacgccggccccggccatcgagcgtctgcagtcccctgaagagcgcgacaagctcgat
ggtctgtacgagtgcattctgtgcgcttgctgctcgacttcctgcccgtccttctggtgg
aacccggacaagttcctgggcccggccgctctgctgcaagcctatcgcttcctggcagac
agccgcgacaccaagacgtccgagcgtctggcttcgctggatgatccgttcagcgtattc
cgctgccgcggcatcatgaactgcgtcaacgtctgtccgaaaggcctgaacccgactaag
gccatcggtcacatacgtaacatgctgctctcgagcggcgtgtga

DBGET integrated database retrieval system