KEGG   Pseudomonas sp. MRSN12121: TO66_14310Help
Entry
TO66_14310        CDS       T03702                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00500  Starch and sucrose metabolism
psem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TO66_14310
Enzymes [BR:psem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TO66_14310
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     TO66_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJO78411
UniProt: A0A0C5E4J2
LinkDB All DBs
Position
3154622..3157963
Genome map
AA seq 1113 aa AA seqDB search
MAKKSRSATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIAELGVNTIW
LLPFYPSPRRDDGYDIAEYRGVSPDYGTLADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKAGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKRIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDFKGDHGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPLYGYLSVNVETQSGDPHSLLNWTRRMLAIRKQSKAFGRGSLKM
LSPSNRRILAYTREYTTEDGRHEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFMLAAENQMPSWHVEPAQSLPDFTTLVLKKRLEELLEAPSRN
TLEQSALPTWLPKRRWFAGKDSAIEQVHIAYGVRFGDPQHPVLLSELEVSGGGQSGRYQL
PFGLLAEEQIGAALPQQLALARVRRGRQVGLITDAFALESFVRNVLQALQAQTVLPCGEG
EIRFQGSAQLAALGLADDVEVRYLSAEQSNSSVVVGGSLVLKLIRKVAAGVHPELEMSAY
LTAAGFQHISPLLGSVVRRDGQGEDSLLMIAQGYLSNQGDAWEWTQNNLERAIRDELADA
MSEQDQHYNALGELQDFAGLLGQRLGEMHRVLAEPSRDPAFGAEPSTARDAQAWAKQIGA
QLERALQLLKQHQAELSVEDQQRVAHWSQHRKAILAYVQELAKQAVGGLRMRVHGDLHLG
QVLVIKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAALALGGPSLDASPQ
TQAVRQRIAERYRHEARAAFVQAYRLATVGLAHAWQDARGEDAALALFSLEKAAYEVAYE
AENRPAWLAVPLRGLQGLLSEVKPFSDTPGGEL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaatccaggtcagccacctttatcaaggacccgctctggtacaaggacgcg
gtgatctaccaggttcacgtcaagtcctatttcgactccaacaatgacgggatcggcgat
tttcccggactgatcgccaagctcgactacatcgccgaactgggcgtgaacaccatctgg
ctgttgccgttctatccctcgccacggcgcgacgatggctacgacatcgccgagtatcgc
ggggtcagccccgactacgggaccctggccgacgcccggcgctttatcgccgaggcccac
aagcgcgggttgcgggtgatcaccgaactggtcatcaaccacacctcggaccagcacccc
tggttccagcgggcacgcaaggccaaggccggctcggcggcgcgggacttctacgtgtgg
tccgacgacgaccagaaatacgacggcacccgcatcatcttcctcgacaccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgtttctactcccatcag
ccggacctcaattttgacaacccgcaggtgatgaaggcggtgctctcggtgatgcgctac
tggctggacatgggcatcgacggtctgcgcctggacgccattccctacctgatcgagcgc
gacggcaccaacaacgagaacctgcccgagacccacgacgtgctcaagcggatccgcgcc
gagatcgatgcgcattacccggaccgcatgctgctggccgaggctaaccagtggccggaa
gacactcagttgtactttggtgacttcaagggcgaccacggcgacgaatgccacatggcc
ttccacttcccgctgatgccgcgcatgtacatggcgctggctcaggaggatcgcttcccg
atcaccgatatcctgcgccagaccccggagattcccgccaactgccagtgggcgatcttc
ctgcgcaaccacgacgagctgaccctggagatggtcaccgaccgcgagcgcgactacctg
tggaactactacgccgccgaccgccgcgcgcggatcaacctcggcatccgccggcgcctg
gcgccgctgatggagcgcgaccggcgccgcgtcgagctgctcaacagcctgctgctgtcg
atgccgggcacaccgaccctgtattacggcgacgagatcggcatgggcgacaacatctac
ctgggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgatcgaccgcaacggcggc
ttctcccgggccgacccggcaagcctggtcctgccgccgatcatggacccgctgtacggc
tacctgtcggtgaacgtcgagacccagtccggcgaccctcattcgctgctcaactggacc
cggcgcatgctggcgatccgcaagcaatccaaggcgttcggtcgcggcagcctgaaaatg
ctgtcgccgagcaaccgccggatcctggcctacacccgcgaatacaccacggaggatggc
cggcacgagatcatcctctgcgtggccaacgtctcgcgcagcgcccaggccgccgagctg
gacctctcggcgttcgccggcatggtgccggtggagatgctgggcgggaacgcgttcccg
ccgatcggccagttgaatttcctcctgaccctggcgccctacggcttctactggttcatg
ctggcggcggaaaaccagatgcccagctggcacgtcgagcccgcccagagcctgccggac
ttcaccaccctggtgctgaagaaacgcctggaagagctgctcgaagcgccgtcgcgcaac
accctggagcagagcgcgctgccgacctggctgcccaagcggcgctggttcgccggcaag
gacagcgccatcgaacaggtgcatatcgcctatggcgtgcgcttcggcgacccgcagcac
ccggtgctgctcagcgagctggaggtcagcggtggcgggcagagcggacgctaccaactg
ccgttcggcctgctcgccgaagagcagatcggcgccgcgctgccgcagcaactggccctg
gcccgggtccggcgcgggcggcaggtggggctgatcaccgacgcctttgccctggagagc
ttcgtgcgcaacgtgttgcaggcgctccaggcgcagaccgtgctgccctgcggcgaaggc
gagatccgtttccagggcagcgcgcaactggcggcgctgggcctggccgacgatgtcgaa
gtgcgctacctgtccgccgagcagtccaacagttcggtggtggtgggcggcagcctggtc
ctcaagctgatccgcaaggtcgccgccggggtccacccggagctggagatgagtgcctac
ctgaccgccgccggcttccagcacatttcgccgttgctcggttcggtggtgcgacgggac
gggcagggcgaggacagtctgctgatgatcgcccagggctacctgagcaaccagggcgac
gcctgggaatggacccagaacaacctggaacgggcgatccgcgacgagctggccgacgcc
atgtccgagcaggaccagcactacaatgccttgggtgagctgcaggatttcgccggcctg
ctcggccagcgcctgggggaaatgcatcgggtcctcgcggagccgagccgcgatccggcc
ttcggtgccgagcccagcacggcccgggacgcccaggcctgggcgaagcagatcggcgcg
caactggaacgcgccttgcagctgctcaagcagcaccaggccgagctgagcgtcgaggac
cagcagcgcgtggcgcactggagccagcaccgcaaggcgatcctggcgtacgtccaggag
ctggcgaaacaggcggtcggcgggctgcgcatgcgggtccacggcgacctgcacctgggg
caggtgctggtgatcaagggcgatgcctacctgatcgacttcgagggcgagccggcacgg
ccgctgcatgagcgacggggcaagcacagcccgtacaaggatgtcagcggcgtgctgcgt
tccttcgactatgccgcggcgctggccctcggcggcccgagcctggatgcgtcgccccag
acccaggccgtgcggcaacggatcgccgagcgttaccggcacgaagcccgcgccgcgttt
gtccaggcctatcgcctggccacggtcggcctggcccatgcctggcaggacgcgcgcggg
gaagacgccgcgctggccctgttcagcctggagaaggcggcttatgaagtggcctacgag
gcggaaaaccgtcccgcctggctggcggtgccgctgcgagggctgcagggcttgttgagc
gaagtgaaacccttttccgatacaccgggtggagagctgtga

DBGET integrated database retrieval system