KEGG   Pseudomonas sp. MRSN12121: TO66_17355Help
Entry
TO66_17355        CDS       T03702                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TO66_17355
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TO66_17355
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TO66_17355
    1.1.1.-  
     TO66_17355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AJO78954
UniProt: A0A0C5E396
LinkDB All DBs
Position
3859393..3860457
Genome map
AA seq 354 aa AA seqDB search
MKALRWHAARDLRLTDLSLPEPGPGQVLVQVAYCGICGSDLHEYADGPHSIPQQQPHPLS
GCRAPLTLGHEFCGQVLAIGPGVEQVQVGSRVAVEPEYRCGDCQYCHAGQYNLCQSMGFI
GLMGDGGFAEQVLVPAYMLHPLPDAVSFKQAAVLEPAAVAFHALNQSRLMAGDSCVVFGL
GPIGLLLILLARLRGVERIFAVDLSPERRRLALDFGAREVLDGRAADLSQRLQELSGGGL
DTAFEAAGSQQTLDLALHSLRKGGEVVLVGLMGEVGFDAFHLVNRELRLVGSVGYRNAYP
PLIELLASGRLDLTRAVTRCVTLEQAVEHGFEALLRDKGQIKVLVNPNPSLAKA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgcgttggcatgccgcccgcgacctgcgcctcaccgacctctcgctgccc
gaacccggcccgggccaggtgctggtgcaggtggcctactgcggtatctgcggcagcgac
ctgcacgaatacgccgacggcccgcactcgattccgcagcagcaaccccacccgctgtcc
ggttgccgcgcacccctgaccctgggccacgagttctgcggccaggtcctggccatcggc
ccgggcgtggagcaggtgcaggtcggcagccgggtggcggtggaacccgaataccgctgc
ggcgactgccagtactgccacgccggccagtacaacctgtgccagtccatgggttttatc
ggcctgatgggcgatggcggcttcgccgagcaggtgctggtgccggcctacatgctgcac
ccgctgccggacgcggtgagcttcaagcaggccgcggtgctggagccggcggcggtggcc
ttccacgcgctgaaccagagccgcctgatggccggcgacagctgcgtggtgttcggcctc
ggccccatcggcctgctgctgatcctgctggcacgcctgcgcggcgtggaacggatcttc
gccgtcgacctcagcccggaacgtaggcggctggccctggatttcggcgctcgggaggtg
ctcgacggccgcgccgccgacctgtcgcagcgcctgcaggaactgagcggtggcgggctc
gacacggccttcgaggccgccggcagccagcagaccctggacctcgccctgcactcgctg
cgcaagggcggcgaggtggtgctggtgggcctgatgggcgaggtcggcttcgatgccttt
cacctggtcaatcgcgaattgcgcctggtcggcagcgtcggctatcgcaacgcctacccg
ccgctgatcgagctgctggccagcggccgcctggacctgacccgcgcggtgacccgctgc
gtgacgctggagcaggcggtggaacacggtttcgaggcgctgctacgggacaagggccag
atcaaggtgctggtcaatcccaacccatcgctggccaaggcatga

DBGET integrated database retrieval system