KEGG   Pseudomonas sp. MRSN12121: TO66_17575Help
Entry
TO66_17575        CDS       T03702                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psem  Pseudomonas sp. MRSN12121
Brite
KEGG Orthology (KO) [BR:psem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TO66_17575
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TO66_17575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 DAO K_oxygenase AlaDh_PNT_C Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJO78997
UniProt: A0A0C5ELY1
LinkDB All DBs
Position
complement(3902798..3904363)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDVASLSSLITLLDNGNDER
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRQIMAVPSIYLNGVNF
GQGRMGLEEILGKLDTGAAEKQAQAISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFVSVQETEGPKLAGALEAHVRQYDVDIMNLQRASALVPAKEAGG
LHEVRFESGATLKAKSLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLHSLPNVDVITSALTSEVKGDG
QKVTGLVYKDRDSGEFNTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgttgcctctctcgacgacggtgcgaaatcccaggaaatgcttgcgctgttg
aaagacgttgccagtctttccagcctgatcaccttgctcgacaacggtaacgatgagcgc
aagccatcgttctcgatcaatcgcccgggagccgacatcagcctgcgtttcgccggcatt
cccatgggccacgaattcacttcgctggtgctggccctgctgcaagtcggcggccaccca
tcgaaagccagtgtcgaagtgatcgaacagatccgcgccctcaagggcgagttcaacttc
gagacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctgaacccgaacatccggcatgtcgccatcgatggcgcgctgttccaggat
gaggtcaacgaccgccagatcatggccgttccgagcatctacctcaacggcgtgaatttt
ggccagggccgcatgggcctggaggaaattctcggcaagctcgacaccggcgcagccgag
aagcaggcgcaagccatcagtgccaaggacgccttcgacgtgctggtggtcggcggtggt
ccggcgggtgcttcggcagcgatctacgcggctcgcaagggcatccgtaccggtgtcgcg
gccgagcgcttcggcggccaggtgctggacaccatggcgatcgagaacttcgtttcggtc
caggaaaccgaagggccgaagctggccggtgccctggaagcccacgtgcgtcagtacgac
gtcgacatcatgaacctgcagcgcgccagcgcgctggtgccggccaaggaagccggcggc
ctgcacgaggtgcgtttcgaaagcggcgcgaccctcaaggccaagtcgctgatcctggct
accggtgcccgctggcgcgagatgggcgtgccaggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatt
ggcggcggtaactccggcgtcgaggcggccatcgacctggcgggtatcgtcagccacgtg
accttgctggagttcgacagcaagctgcgcgccgacgcggtattgcaacgcaagctgcac
agcctgccgaacgtcgacgtcatcaccagcgcgctgaccagcgaagtgaagggcgacggc
cagaaggtcaccggcctggtgtacaaggaccgcgattcgggtgagttcaacacggtcgac
ctggaaggcatcttcgtgcagatcggcctgttgccgaacaccgactggctcaagggcacc
gtcgagctgtcgccccgtggcgagatcattgtcgatgcccgcggcgagacctcgctgcct
ggtgtgtttgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgcggta
ggcgagggcgccaaggcttcgctcagtgccttcgaccacctgatccgcacttccgcgccg
gcctga

DBGET integrated database retrieval system