KEGG   Pseudomonas sp. MRSN12121: TO66_22025Help
Entry
TO66_22025        CDS       T03702                                 

Definition
(GenBank) peptide synthase
Organism
psem  Pseudomonas sp. MRSN12121
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2 AATase
Motif
Other DBs
NCBI-ProteinID: AJO79805
UniProt: A0A0C5ED20
LinkDB All DBs
Position
complement(4867982..4880998)
Genome map
AA seq 4338 aa AA seqDB search
MMDAFELPSTLAQALQRRAAQTPDQVALRFLAEEQDQNVVLSYSDLDRRARTIAAALQAN
AGLGDRAVLLFPSGPDYVAAFFACLYAGVIAVPAYPPESSRRHHQERLISIIADAEPRLL
LTSGGLRDSLAQMDALQGAAAPQLLCVDSLPASLAEGWSPIELQGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPAYFLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSE
PIRLDTLERFAEKFAACGFTPNQFFASYGLAEATLFVAGGTRGQGIPALRLDEQALAQNR
AEPGNGNAMMSCGTSQPEHAVLIVEPNSLAELAENLVGEVWAAGPSIAHGYWRNPEATAK
TFVQHAGRTWLRTGDLGFMRGGELFITGRLKDMLIVRGHNLYPQDIEQTIEREVEVVRKG
RVAAFAVSDQGQEGIGIAAEISRSVQKILTPDALIKLIRQTVAEAYQEAPSVVVLLNPGA
LPKTSSGKLQRSACRNRLADGSLDSYAVFPDCQAAKSEAGGDTASALQDLVGRIWREQLQ
VEQVASDDHFFLLGGNSIAATQVVARLREELGLELNLRLLFEAPTLGAFAARVAQLQQDG
GLAQGSIHALPRSEALPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDPHALRASFQ
HLIERHESLRTRFFERDGQALQQVLPAGEFDLRTIDLSDLPPAEREARAQQIREDEARTR
FDLEQGPLLWVTLVRLDDEEHLLLVTLHHIIADGWSLNVLIDEFSRLYAGASQGQAVALA
PLPLQYADYGSWQRQWLAEGEGERQLAYWKQRLGDEHPSLGLATDHPRSAQQQHSAARHS
LRLGASLSEAIRQTAQAHESTPFMLLLTAFQSLLHRYSGQRDIRIGVPNANRPRLETQGL
IGFFINTLVLRAEVQGRLPFVELLAHTRQAALQAQAHQDLPFEQLLEAFPQAREQGLFQV
MFNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLSFDYANELFKAA
TIERLAEHFVSLLRAACERPQTAIADLPLLNPCEQAQQHQWGEAPCAPASQWLPELLEHQ
AQLTPERTALLWEGGELSFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLA
ILKAGGAYVPLDPDYPAERLAYMLADSGVALLLTQTHLLERLPRAAGVSAIAMDSLKLDN
WPSHAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALSERLQWMQDTYRLDASDVLMQK
APISFDVSVWECFWPLITGCRLLLAAPGEHRDPHRIAQLVQHYGVTTLHFVPPLLQLFVD
EPLAAGCSSLRRVFSGGEALPAELRDRLLAQLPDTQLHNRYGPTETAINVTHWQCRSSDG
ERSPIGRPLGNVVCRVLDADLNPVPAGVPGELCIAGSGLARGYLGRPGLSAERFVVDPLS
TEGARLYRTGDRVRWGADGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQAGVAQAAVLV
RETAAGAQLIGYYTASVAGEDEAAQNERLKTALASELPEYMVPAQLLRLDAMPLSPSGKL
DRRALPEPQWQVREHVEPATELQRQIAAIWREVLGLQRIGLRDDFFALGGHSLLATQIIS
RTRQACDVELPLRALFEASELGDFAEQVRLIQEAGQRNQQLPIAKVDRSAPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARFKGVLDVGRFEAALQALILRHETLRTTFPSVDGVARQRV
HAETGVRMAWKDFSALDAASREQRLQQLADSEAHLPFDLETGPLLRACLVKAAEQEHYFV
LTLHHIVTEGWAMDIFARELSALYEAFVDDRDSPLEPLPVQYLDYSVWQRQWLESGERQR
QLDYWTAQLGHEHPLLELPGDRPRPPVQSHQGELYRFDLSDELAARVRRFNAENGLTLFM
TMTATLAVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELL
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVE
YLANDARATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAAHWRNLLEALLADPER
RLSELPLLDSAEQQQLLDSLGVEPGVHRLDQCIHHLFSEQALLRPDAPALTFAGQTLSYA
ELDGRANRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRL
HYMIEDSGIGLLLSDAAMFAALGELPPTVARWCLEEDGARLADYPAGELPFISLPQHQAY
LIYTSGSTGKPKGVVVSHGEIAMHCRAVIERFGMRPDDCELHFYSINFDAATERLLVPLL
SGAQVVLRAQGQWDAEAICQLIREHRINILGFTPSYGSQLAQWLATQGQTLPVRMCITGG
EALTGEHLSRIRAAFQPSLFFNAYGPTETVVMPLASLAPQQLEEGVGSVPIGTVIGDRVA
YILDADLALVPQGATGELYVGGAGLAQGYHQRPGMSAERFVADPFSAQGGRLYRTGDLVR
QCTDGQVEYIGRVDHQVKIRGFRIELGEIESRLLEHDAVREAVVLALDMPGGKQLAGYLV
TDVAEQGDEAQAELREALKAQLKTQLPDYMVPTHLILLASMPLTANGKLDRRALPAPDLE
LNRQQYVAPSSELERTLAQIWREVLNLSQVGLHDNFFELGGDSILSIQVVSRARQQGIHF
SPRDLFQHQTVQTLAAVASRSEQIVAEQGLLSGESGLTPIQHWFFDSEIAERHHWNQALL
LEPTQALDARRLEQALQQVLAQHDALRLRFTQVAGQWQAEHQPLAEAPLLVPLRVDSMEQ
CTALFAEAQRSLDLGHGPLWRALLVDGPDGQQRLFIAIHHLVVDGVSWRVLLEDLQSVYR
QLEAQQTPRLPAKTSALRDWASRLLAYAGSESLREESSWWQDQLAGPTVALPVQNADGGQ
QNKHARSVSVTLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWTGEASALIQLEGH
GREALFDEIDLTRTVGWFTSAYPLRLTPVAVEAAAGQGASIKAIKEQLRAVPHKGLGYGV
LRYLAEATIRQGMAALPQAPVTFNYLGQFDQSFASDALFRPLDEPLGAAHSPEAPLPNEL
SVDSQVYAGQLVLRWTFSGERFDVQTIDALAQAYLDELHSLIAHCLQDEAGGLTPSDFPL
ARLTQAQLDALPVPASVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPER
FARAWQAVVARHEALRASFCWNVGEAMLQVIHKPGSTPVEYLDWSAVAEAEQEPKLQALL
KSEREAGFDLLNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEVYTALGE
GREAQLAVPSRYRDYIGWLQRQSLAEARQWWQDNLRGFERTTPIPSDRPFLREHAGDSGG
MLVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRLSGDRDVLFGVTVAGRP
VEMPQMQRTVGLFINSIALRVKLPEDGQRCGVRQWLSGLLDSNMQLREYEYLPLVAIQES
SELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPITAVCYPGDDLGLH
LSYDQRYFERETIERMLGEFKRLLLALVQGFHGDMAELPLLGEEEQDFLLAGCNQSARDY
PLQRSYVELFEAQVAAHPQRIAASCQDLQYSYAELNQRSNRLGHALIAQGVGLDQPVALL
AERGLELLGMIVGSFKAGAGYLPLDPGLPGQRLARIIELSRTPLLVCSAACLEQARALLD
EFACANRPRLLVWDEVQAGGHSPENPGVYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLN
NQLSKVPYLQLSEADMIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGLLAHV
QAQGITVLESVPSLIQGMLAQDSIDLDSLRWMLPTGEAMPPELAHQWLLRYPQVGLVNAY
GPAECSDDVAFYRVDMASTRGSYLPIGTPTDNNRLYLMDGALQLVPLGAVGELCVAGTGV
GRGYVSDPLRTAQVFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGYRIE
LGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVASDSALSPSERLERIKQRLRAELPE
YMVPLHWLWLERLPLNANGKLDRKALPALEIGQLQSTDYLAPRSELEQTLADIWAEVLKV
EQVGVRDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVEELAHYIDGLANSEI
NEEKVDRLSDLMAELEGL
NT seq 13017 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgcgttcgaactccccagcactctggctcaagcccttcaacgccgggcggcg
cagacccccgatcaagtggccttgcgctttcttgccgaagagcaggatcagaacgtggtc
ctcagctacagcgacctggaccggcgcgcccggaccatcgccgcagcgctgcaagccaac
gccgggctgggcgatcgcgcggtgctgctgttccccagcggcccggactatgtcgcggcc
tttttcgcctgcctgtatgccggcgtcatcgcggtgccggcctatccgccggagtcgagc
cggcgccatcaccaggagcggctgatctcgatcatcgccgacgccgagccgcggttgctg
ctgaccagcggcgggttgcgcgactccctggcgcagatggacgcactgcaaggtgccgct
gcgccgcagctgctctgcgtggacagcctgccagccagcctggccgaaggctggagcccg
atcgagttgcagggcgacgacatcgccttcctgcaatacacctccggttccacggcgttg
cccaagggcgtgcaagtcagccacggcaacctggtggccaacgagctgctgatccgccgc
ggcttcggcatcgacctcaacccggacgacgtgatcgtcagctggctgccgctgtaccac
gacatggggctgatcggcggcctgctgcaaccgatcttcagcggcgtgccctgcgtgttg
atgtcgccggcgtatttcctcggccggccgttgcgctggctggaggcgatcagtgaatac
ggcggcaccatcagcggcggtccggacttcgcctaccgcctgtgcagcgagcgggtcagc
gagtcggcgctggaacgcctcgatctcagccgctggcgcgtggcctattccgggtccgag
ccgatccgcctggacaccctggagcgcttcgctgagaagttcgccgcctgcggtttcacc
ccgaatcagttcttcgcttcctatggcctggccgaagccaccctgttcgtcgccggcggc
acccgcggtcagggcatcccggccctgcgcctggacgagcaggccctggcgcagaaccgc
gccgagccgggcaacggcaacgccatgatgagctgcggcaccagccagcccgagcacgcg
gtgctgatcgtcgagcccaacagcctggccgaactggcagagaacttggtgggcgaagtc
tgggccgccggcccgagcatcgcccacggctactggcgcaaccccgaggccacggccaag
accttcgtccagcacgccggccggacctggctgcgcaccggcgacctgggtttcatgcgc
ggtggcgagctgttcatcaccggccgcttgaaagacatgctgatcgtgcgcgggcacaac
ctttatccacaggacatcgagcaaaccatcgagcgggaagtcgaggtggtgcgcaagggc
cgggtcgcggcgttcgccgtcagcgaccagggtcaggaaggcatcggcatcgccgcggaa
atcagccgcagcgtgcagaagatcctcacgcccgacgcgctgatcaaactgatccgccag
accgtggccgaggcctaccaggaagcgccgagcgtggtggtattgctcaaccccggcgcg
ttgcccaagacctccagcggcaagttgcagcgctccgcctgccgcaaccgcctggccgat
ggcagcctcgacagctatgcggtcttccccgactgccaggcggcgaagagcgaggccggc
ggcgacaccgccagtgcactgcaagacctggtcggccgcatctggcgcgagcagctgcag
gtcgagcaggtggcgagcgacgatcacttcttcctgctgggcggcaactccatcgccgcg
acccaggtggtggcacgcctgcgcgaagaactcggcctggagctgaacctgcgcctgctg
ttcgaggcgccgaccctgggggccttcgccgcccgggtggcgcagttgcaacaggacggc
ggcctggcccagggcagcatccatgccttgccgcgcagcgaggcactgccgcagtccctg
gcgcagaaccgtctgtggatcacctggcagctcgacccgcagagcagcgcctacaacatt
cccggcggcctgcgcctgcgcggcgagctggacccgcacgccctgcgcgccagcttccag
cacctgatcgagcgtcacgaatccctgcgcacgcggtttttcgagcgcgacggccaggcg
ctgcaacaggtgctgccggccggcgaattcgacctgcgcacgatcgacctcagcgacctg
ccgccggccgagcgcgaggcgcgggcgcagcagatccgcgaggacgaggcccgcacccgg
ttcgacctggagcagggcccgctgctgtgggtgaccctggtgcgcctcgacgacgaggaa
cacctgttgctggtgaccctgcaccacatcatcgccgacggctggtcgctgaatgtgctg
atcgatgagttctcgcggctgtatgccggtgcgtcccagggccaggcggtggcgttggcg
ccattgccgttgcagtacgccgactacggcagctggcagcgccagtggctggccgagggc
gaaggcgagcggcaactggcctactggaaacagcggttaggcgacgagcacccgagcctg
ggcctggccaccgatcacccgcgttcggcgcaacagcaacacagcgccgcgcgccacagc
ctgcgcctgggggcgagcctgagcgaggcgattcgccagactgcccaggcccatgaatcc
acaccgttcatgctgttgctcacggcgttccagagcctgctgcatcgctacagcggccag
cgcgatattcgcatcggcgtgcccaacgccaaccgtccgcgcctggaaacccagggcctg
atcggcttctttatcaacaccctggtgctgcgtgccgaggtgcaaggccgcctgccattc
gtcgagctgctggcgcacacccgccaggccgcgctacaggcccaggcccaccaggacctg
ccgttcgagcaactgctcgaagccttcccccaggcccgggaacaggggctgttccaggtc
atgttcaaccaccagcagcgtgacctcagtgccctgcgccgcttgcccgggctgctggcc
gaagaactgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaggaa
gaccgcaacggccgcctcagcctgtccttcgactacgccaacgagctgttcaaggccgcg
accatcgagcgtctggccgagcatttcgtcagcctgctgcgcgccgcttgcgagcgtccg
caaaccgccatcgccgatctgccgttgctcaacccctgcgagcaggcgcagcagcaccag
tggggcgaagcaccgtgcgcgccggccagccagtggctgccggagctgctggagcatcag
gcgcaactgaccccggagcgcaccgcgctgctgtgggagggcggtgagctgagcttcgcc
gagctgcacgcccaggccaaccgcctggcccattacctgcgcgacaagggcgtcggcccg
gatgtgtgcgtggcgattgccgccgagcgttcgccacaattgctgatcggcctgctggcg
atcctcaaggccggcggcgcctatgtgccgctggacccggactacccggccgagcgcctg
gcctacatgctggccgacagcggcgtcgcgctgctgctgacccagacccatctgctcgaa
cgcctgccccgagccgcgggcgtcagcgccatcgccatggacagcctcaagctcgacaac
tggccgagccacgcgccgggcctgcacctgcacggcgacaacctggcctatgtgatctac
acctccggttccaccggccagcccaagggcgtgggcaacacccatgcggccctgagcgaa
cgcttgcagtggatgcaggacacttaccgcctggacgccagcgacgtgctgatgcaaaag
gccccgatcagcttcgacgtgtcggtgtgggagtgcttctggccgctgatcaccggctgc
cgcctgctgctggcggcgccgggcgaacaccgcgatccgcatcgcatcgcccagttggta
cagcactacggcgtgaccacgctgcacttcgtgccgccgctgttgcagctgttcgtcgac
gagccgctggccgctggatgcagcagcttgcgccgggtgttctccgggggcgaagccctg
ccggccgagctgcgcgaccgcctgctggcgcagctgcccgatacccagttgcacaaccgc
tatggcccgaccgaaaccgcgatcaacgtcacccactggcagtgccggagcagcgatggc
gagcgttcgcccatcggccgcccgctgggcaacgtggtctgccgggtgctggacgccgac
ctcaacccggtgccggccggggtgccgggcgagctgtgcattgccggcagcggcctggcc
cggggctacctcgggcggccggggctgagcgccgagcgttttgtggtcgacccgctgagc
accgagggtgcgcgcctgtaccgcaccggcgaccgcgtgcgctggggcgccgacggtgcg
ctggaatacctcggccgcctcgatcagcaggtcaagctgcgcggttttcgcgtcgaaccc
caggaaatcgaagcacggctgctggcccaggccggcgtggcccaggccgcagtgctggtg
cgcgagaccgcggccggcgcgcagttgatcggctactacaccgcgagcgtcgccggggag
gatgaggccgcgcagaacgagcgcctgaaaaccgccctggccagcgagctgccggaatat
atggtgccggcgcaactgctgcgcctggacgcgatgcccctgagcccgagcggcaagctc
gaccgccgcgccttgcccgagccgcagtggcaggtacgcgaacacgtcgagccggcgacc
gagctgcaacggcagatcgcggcgatctggcgcgaggtgctgggcctgcaacgcattggc
ctgcgcgacgacttcttcgccctgggcggccactcgctgctggcgacccagatcatttcc
cgcacccgccaggcctgcgacgtcgagttgccgctgcgggcgctgttcgaagccagcgag
ctgggcgacttcgccgagcaggtgcggctgatccaggaagccggccagcgtaaccagcag
ttgccgatcgccaaggtcgaccgcagcgcgcctgtgccgctgtcgtattcccagcagcgc
atgtggttcctctggcagatggagccggacagcccggcctacaacgttggcggcatggcg
cgcttcaagggcgtgctggatgtcgggcggttcgaggcggcgttgcaggcgttgatcctg
cgccatgaaaccctgcgcaccactttccccagcgtcgatggcgtggcccggcaacgggtg
cacgcggaaaccggcgtgcgcatggcctggaaggatttctcggccctggatgccgccagc
cgcgagcaacgcctgcaacagctggccgacagcgaagcgcacctgccgttcgacctggag
accggcccgctgctgcgcgcctgcctggtcaaggcggcggagcaggagcactacttcgtg
ctgaccctgcaccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgagctg
agcgcgctgtacgaagcctttgtcgacgaccgtgactcgccgctggagccgctgccggtg
cagtacctggactacagcgtctggcaacggcagtggctggaatccggcgagcgccagcgc
cagctggactactggaccgcgcagctgggccacgaacacccgctgctggaactgccgggc
gaccggccgcggccgccggtgcaaagccaccagggcgagctgtaccgcttcgacctcagc
gacgagctggcggcgcgggtgcggcgcttcaatgctgagaacggcctgaccctgttcatg
accatgaccgccaccctggcggtgctgctctatcgctacagcggccagaccgacctgcgc
atcggcgcgccggtggccaaccgcatccgcccggaaagcgaagggctgatcggcgccttc
ctcaatacccaggtgctgcgttgccggctcgacgggcagatgagcgtcggcgagttgctg
gagcaggtacggcatacggtgatcgagggccagtcgcaccaggacctgccgttcgaccac
ctggtggaagccctgcaaccgccgcgcagcgccgcctacaacccgctgttccaggtgatg
tgcaacgtccagcgctgggagttccagcagagccgcaccctggccggcatgaccgtggaa
tacctggccaacgacgcccgggccaccaagttcgacctcaacctggaagtcaccgacctc
gaccaccgcctgggttgctgcctgacctacagcaccgacctgttcgacgaaccgcgcatc
gcgcgcatggccgcgcactggcgcaacctgctggaagcgctgctggccgaccccgagcgg
cgcctgagtgagttgccgctgctcgacagcgccgagcaacaacagctgctggacagcctg
ggcgtcgagcccggcgtgcatcgcctcgaccagtgcatccatcacttgttcagcgagcag
gcgctgctgcgcccggacgccccggccctgaccttcgccgggcagaccctgagctacgcc
gaactcgacggccgcgccaaccgcctggcctggatgctccgcgagcgcggcgtcggcccg
caggtgcgggtaggcctggccctggaacgttcgctggaaatggtcgtcggcctgctggcg
atcctcaaggccggcggcgcctatgtgccgctggacccggaatacccgctggaccgcctg
cactacatgatcgaagacagtggcatcggcctgctgctcagcgacgcggcgatgttcgcc
gccctcggcgagctgccgccgactgtggcgcgctggtgcctggaggaagacggcgcgcga
ctggccgactacccggccggtgagctgccgtttatcagcctgccgcagcaccaggcgtac
ctgatctacacctccggttccaccggcaagcccaagggcgtggtggtgtcccacggcgag
atcgccatgcactgccgcgcagtgatcgagcgtttcggcatgcgcccggacgactgcgag
ctgcacttctattcgatcaacttcgatgccgccaccgagcgcctgctggtgccgctgctc
agcggtgcccaggtggtgttgcgcgctcaggggcaatgggacgccgaagcgatctgccaa
ctgatccgcgagcaccgcatcaatatcctcggtttcaccccgagctacggcagccagctg
gcgcagtggctggcgacccagggccagacgctgccggtgcgcatgtgcatcactggcggc
gaggcgctgaccggcgaacacctgagccggatccgcgctgccttccagccgagcctgttc
ttcaacgcctacggccccaccgagaccgtggtcatgccgttggccagcctggcgccgcag
cagctggaggagggcgtgggcagcgtgccgatcggcacggtgatcggcgatcgcgtggcc
tatattctcgacgctgatctggccctggtgccccagggcgccaccggcgagctgtatgtc
ggcggcgccggcctggcccaggggtatcaccagcgcccgggcatgagtgccgagcgtttt
gtcgccgacccgttcagcgcgcagggcgggcgcctgtaccgtaccggcgacctggtgcgc
cagtgcaccgacggccaggtggaatacatcggccgggtcgaccatcaggtgaagatccgc
ggtttccgcatcgagctgggggaaatcgaaagccgcctgctggaacatgacgcggtgcgc
gaagcggtggtgctggccctggacatgccgggcggcaaacagctggccggttatctagtg
accgatgtcgccgagcagggcgacgaggcccaggcagagctgcgcgaggcgctcaaggcc
cagttgaaaacccagctgccggactacatggtgccgacccacctgatcctgctggcgagc
atgccgctgaccgccaacggcaagctcgaccgccgcgccttgccggcgccggacctggag
ctcaaccgccagcagtacgtggcgccgagcagcgaactggaacggaccctggcacagatc
tggcgcgaggtgctgaacctgtcgcaggtcggcctgcacgacaacttcttcgagctgggc
ggcgattcgatcctgtcgatccaggtggtcagccgcgctcgccagcagggtattcatttc
agcccacgcgacctgttccagcaccagaccgtgcagaccctggccgcggtggccagccgc
agcgaacagatcgtcgccgagcagggactgctcagtggcgagtcgggcctgacgccgatc
cagcactggttcttcgacagcgaaatcgccgagcggcaccactggaaccaggccctgttg
ctggagccaacccaggcactcgatgcccggcgcctggaacaggcgctgcaacaggtgctg
gcccagcatgacgccttgcgcctgcgtttcacccaggtggccggccagtggcaggctgag
catcagccgctggccgaagcgccgctgctggtgccgctgcgcgtggactcgatggaacag
tgcacggcactgttcgccgaggctcagcgcagcctcgacctgggccacggaccgctgtgg
cgcgccctgctggtggacggcccggacggccagcaacggctgtttatcgccatccaccac
ctggtggtcgacggcgtgtcctggcgcgtattgctggaagatctacagagcgtgtatcgc
cagctggaagctcagcagacgccgcgcctgccggcgaaaaccagcgccttgcgcgattgg
gcgtcccgcctgctggcctatgccggcagcgagtcgctgcgcgaagagtcgagctggtgg
caggaccaattggccgggccgacggtggcgttgccggtgcagaacgccgatggcgggcag
caaaataaacacgcccgcagcgtcagcgtgacgctcgacgccgagcgtacccggcagctg
ctgcaacaggcgccgagcgcctaccgcacccaggtcaacgacctgctgctgaccgccctg
gcccgcgtgctgtgtcgctggaccggcgaggcatcggccttgatccagctcgaaggccac
ggccgcgaagccctgttcgacgagatcgacctgacccgcaccgtcggctggttcaccagc
gcctacccgctgcgcctgaccccggtggcggtcgaagcggcggccgggcagggcgcctcg
atcaaggcgatcaaggagcaactgcgcgccgtaccgcacaagggcctgggttatggcgtg
ctgcgctacctggccgaggcgacgatccgccagggcatggcggccctgccgcaggcgccg
gtcaccttcaactacctggggcagttcgaccagagctttgccagcgacgcgctgttccgg
ccgctggacgagccgctgggcgccgcccattcgcccgaggcgccgctgcccaacgagctg
agtgtcgacagccaggtctatgccggccagctggtgctgcgctggaccttcagcggcgaa
cgtttcgacgtgcagaccatcgacgcgctggcccaggcctacctcgacgaactgcacagc
ctgatcgcccattgcctgcaagacgaggccggtggcctgacgccgtcggacttccccctg
gcgcgcctgacccaggcgcagctggacgcgctgccggtgccggccagcgtgatcgaggac
gtctacccgctgaccccgatgcaggaaggcatgctgctgcacaccctgctggaaccgggc
accggcctgtactacatgcaggaccgctaccgcatcaacagcgagctggaccccgagcgc
ttcgcccgggcctggcaggcggtggtggcccgtcacgaagccctgcgcgcgtccttctgc
tggaacgtcggcgaagccatgctgcaggtgatccacaagccgggcagcacgccggtcgag
tacctggactggagcgccgtggccgaggccgagcaggaaccgaagctgcaggcgctgctg
aagagcgagcgcgaggccggtttcgatctgctcaaccaggcgccgttccacctgcgcctg
atccgcgtgggcgccgcgcgctactggttcatgatgagcaaccaccacatcctgatcgat
gcctggtgccgttcgctgctgatgaacgacttcttcgaggtctacaccgccctcggcgag
gggcgcgaagcccagctggccgtgccgagccgctaccgcgactacatcggctggctgcaa
cgccagagcctggccgaggcgcgccagtggtggcaagacaacttgcgcggcttcgagcgc
actacgccgattccgagcgaccggccgttcctgcgcgaacacgccggcgacagcggcggc
atgctggtcggcgattgctacacccgcctggatgcccgcgacggcgcgcaattgcgtgag
ctggcgcagcagcaccagctgaccgtcaacaccttcgcccaggcggcctgggccctggtc
ctgcggcgcctgagcggcgaccgcgacgtgctgttcggcgtcaccgtggccgggcgtccg
gtggagatgccgcagatgcagcgcaccgtcggcctgttcatcaacagcatcgcgctgcgg
gtgaaactgccggaagacggccagcgctgcggcgtgcgccagtggctcagcggcttgctg
gacagcaacatgcagctgcgcgagtacgagtacctgccgctggtggcgatccaggaaagc
agcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccg
gtggaagtctcggtgctggaccgggcgcaaagcctgaacgccacctcggattccggccgt
acccacaccaacttcccgatcaccgcggtgtgctacccgggggacgacctggggctgcac
ctgtcttacgaccagcgttacttcgaacgcgagaccatcgagcgcatgctcggcgagttc
aagcgcctgctgctggcgctggtgcagggcttccatggcgacatggccgagttgccgctg
ctgggcgaagaggagcaggacttcctgctcgccggctgcaaccagagcgcgcgggactat
ccgttgcagcgcagctacgtcgagctgttcgaggcccaggtggcggcgcatccgcaacgc
atcgccgccagttgccaagacctgcaatacagctacgccgagctgaaccagcgcagcaac
cgcctcggccatgcgctgatcgcccagggcgtgggcctggaccagccggtggcgctgctg
gccgaacgcggcctggagctgctgggcatgatcgtcggcagcttcaaggccggcgccggc
tacctgccgctggatccgggcctgccgggccagcgcctggcgcggatcatcgagctcagc
cgcacgccgctgctggtgtgcagcgcggcctgcctggaacaggcgcgagccctgctcgac
gaattcgcctgcgccaaccggccgcggctattggtttgggacgaggtccaggcgggcggc
cattcgccggaaaacccgggcgtctacagcggcccggataacctggcctacgtgatctac
acctcgggctccaccggcctgccgaaaggcgtgatggtcgagcagcgcggcatgctcaac
aaccagctgagcaaggtgccgtacctgcaattgagcgaagccgacatgatcgcccagacc
gcgtcgcagagcttcgacatctctgtctggcagttcctcgccgcgccgctgttcggtgcg
cgggtggacatcgtgccgaacaccatcgcccatgacccgcaaggcttgctggcccatgtg
caggcgcagggcatcacggtgctggagagcgtgccgtcgctgatccagggcatgctcgcc
caggacagcatcgatctcgacagcctgcgctggatgctgccgaccggcgaggcgatgccg
ccggagctggcgcaccaatggctgttgcgttatccacaggtcggcctggtcaacgcctat
ggtccggccgagtgctccgacgatgtggccttctaccgcgtcgatatggcctcgacccgt
ggcagctacctgccgatcggcacgcccaccgacaacaaccgcctgtacctgatggacggc
gcgctgcaactggtgccgctgggcgcggtgggcgagctgtgcgtggccgggaccggggtc
ggccgcggttatgtcagcgacccgctgcgcaccgcccaggtgttcgtgccgcatccgttc
ggggctccgggcgaacgcctgtaccgcaccggcgacctggcccggcgccgcgccgatggc
gtgctggaatacgtcgggcgcatcgaccatcaggtgaagatccgcggctaccgcatcgaa
ctgggggaaatcgaagcgcgcctgcacgaacagccggaagtccgcgatgcggcggtcggg
gtgcaggaaggggtcaatggcaagcacctggtgggctatctggtggccagtgactcggct
ctcagtccgagcgaacgcctggaacgcatcaagcagcgcctgcgtgccgagttgccggaa
tacatggtgccgctgcactggctgtggctggagcgcctgccgctcaacgccaacggcaag
ctcgaccgcaaggccctgccggccctggagatcggccagttgcagagcaccgactacctg
gcgccgcgcagcgagctggaacagaccctggccgatatctgggccgaggtgctcaaggtc
gagcaggtgggcgtgcgcgacaacttcttcgagctgggcgggcattcgctgctggccacg
cagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgctgcgggccatgttc
gagtgcagcacggtggaggaactggcgcactacatcgatggcctggcgaacagtgaaatc
aacgaggagaaggtcgatcggctgagcgatctgatggcggagctggaggggctgtaa

DBGET integrated database retrieval system