KEGG   Pseudomonas sp. MRSN12121: TO66_24700Help
Entry
TO66_24700        CDS       T03702                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psem  Pseudomonas sp. MRSN12121
Brite
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TO66_24700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJO80303
UniProt: A0A0C5E224
LinkDB All DBs
Position
5451198..5451794
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWKFVAEQFEGKTFVA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctacgcacacgatgccctgcagccgcacatttcc
aaggaaaccctggaataccaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaagaccctggaagagatcgtcaagtcctcc
tcgggcggtattttcaacaacgccgctcaggtctggaaccacactttctactggaactgc
ctggcgccaaacgccggcggccagccaaccggcgcactggcggaagccatcaacgcagcg
ttcggttcgttcgacaagttcaaggaagaattcaccaagacttccgtcggcaccttcggc
tccggctggggctggctggtgaaaaaggctgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcttactacatcgactaccgcaacctgcgtccaaagtatgtcgaagcgttctggaac
ctggtcaactggaaattcgtggccgagcagttcgaaggcaagaccttcgtcgcctga

DBGET integrated database retrieval system