KEGG   Pseudomonas sp. MRSN12121: TO66_26390Help
Entry
TO66_26390        CDS       T03702                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00473  D-Alanine metabolism
psem00550  Peptidoglycan biosynthesis
psem01100  Metabolic pathways
psem01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TO66_26390
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TO66_26390
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TO66_26390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psem01011]
    TO66_26390
Enzymes [BR:psem01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TO66_26390
Peptidoglycan biosynthesis and degradation proteins [BR:psem01011]
 Precursor biosynthesis
  Amino acid ligase
   TO66_26390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AJO80626
UniProt: A0A0C5EBA2
LinkDB All DBs
Position
complement(5806230..5807324)
Genome map
AA seq 364 aa AA seqDB search
MSKLRVGIIFGGRSAEHEVSLQSARNIVDALDRERFEPVLIGIDKHGHWHLNDTSNFLIN
QENPALIALNQSNRELAVVPGKASQQLVETSSQELLGHVDVIFPIVHGTLGEDGCLQGLL
RMADLPFVGSDVLGSAVCMDKDVSKRLLRDAGLAVTPFITLNRATAARTDFAQAQGKLGL
PMFVKPANQGSSVGVSKVTSEAEYRAALEQALGFDEKVLVESAVSGREIECAVLGNDQPI
ASGCGEIVVGSGFYSYDSKYIDDQAAQVVVPADLSEEVSERIRALAVEAFQVLGCSGLAR
VDVFLTQGGEVLINEINSLPGFTRISMYPKLWQAAGMSYSELVSRLIELALERHAARRAL
KISR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgcgggtcgggattatttttggcggccgttcggccgaacacgaagtgtcg
ctgcagtcggcacgcaatatcgtcgatgcgctggatcgcgagcgcttcgagccggtgctg
atcggcatcgacaagcacggccactggcacctcaacgacacctcgaacttcctgatcaac
caggaaaacccggcgctgatcgccctcaaccagtccaaccgcgaactggcggtggtgccg
ggcaaagccagccagcagttggtggaaacctccagccaggagctgctggggcatgtcgat
gtgattttccccatcgtccacggcaccctcggcgaggacggttgcctgcaaggcctgttg
cgcatggccgacctgccgttcgtgggctccgatgtgctggggtcggcggtgtgcatggac
aaggacgtcagcaagcgcctgctgcgcgacgccggcctggcggtgacgcctttcatcacc
ctgaaccgggccaccgcggcgcgcaccgattttgcccaggcgcagggcaagctgggcctg
ccgatgttcgtcaagccggcgaaccaggggtcgtcggtgggggtcagcaaggtcaccagc
gaggccgaatatcgcgcggccctcgagcaggcgctgggcttcgacgagaaggtgctggtg
gagtcggcggtcagcggccgtgagatcgaatgcgcggtgctgggcaacgaccagccgatt
gccagtggttgcggggaaatcgtggtcggtagcggcttctattcctacgacagcaaatac
atcgacgaccaggcggcccaggtggtggtgccggcggacctcagcgaggaagtcagcgag
cgcattcgcgccctggccgtcgaggcgttccaggtgctgggctgctcggggctggcgcgg
gtcgatgtgttcctgacccagggcggcgaagtgctgatcaacgagatcaattcgctgccc
ggcttcacccgcatcagcatgtaccccaagctgtggcaggccgcgggcatgagctacagc
gaactggtcagccgcctgatcgaactggcgctggaacggcatgcggcgcgccgggccttg
aaaatcagccgttga

DBGET integrated database retrieval system