KEGG   Pseudomonas sp. MRSN12121: TO66_27605Help
Entry
TO66_27605        CDS       T03702                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00550  Peptidoglycan biosynthesis
psem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TO66_27605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psem01002]
    TO66_27605
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psem01011]
    TO66_27605
Enzymes [BR:psem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TO66_27605
Peptidases and inhibitors [BR:psem01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   TO66_27605
Peptidoglycan biosynthesis and degradation proteins [BR:psem01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   TO66_27605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJO80849
UniProt: A0A0C5E876
LinkDB All DBs
Position
complement(6072390..6073547)
Genome map
AA seq 385 aa AA seqDB search
MNITTFAKRLCLLVPLIITPAAWAVEVMPSPPQLAAKSYVLMDASSGNVLVENNGDQRLP
PASLTKLMTAYIATLEIRRGQIGENDPVTVSENAWRTGGSRMFIKVGSQVTVSDLLHGII
IQSGNDASVAVAEHIAGSEDAFADMMNKTAGDLGMSNSHFMNPTGLPNPEHYSSAHDMAV
LARAIIHEDPAHYAIYSQKEFFWNGIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCMVSSA
VRDGMRLIAVVFGTNSEQARAAETQKLLTYGFRFFETQTFYQKGTELAQAPVWKGTTSQV
KAGLAEDLTMTMPKGQLKKLAASMTMNPQLVAPIAKGDVIGKVEVKLDDKVVHSADLIAL
DAVDEGGIFRRMWDSIRLFFYGLFN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccacctttgccaaacgcctgtgtctgcttgtcccgctgatcatcacgcct
gccgcctgggcggtagaagtgatgccgtcgccgccgcagctggccgccaagtcctatgtg
ctcatggatgccagcagcggtaacgtgctggtggagaacaacggtgaccagcgtctgccg
cctgccagcctgaccaagctgatgaccgcctatatcgcgaccctggaaatccgtcgcggc
cagatcggcgagaacgacccggtgaccgtcagcgagaacgcctggcgtaccggcggttcg
cggatgttcatcaaggtgggttcgcaggtcacggtcagcgatctgctgcacggcatcatc
atccagtcgggtaacgacgccagtgtcgcggtggccgagcacatcgccggcagcgaagac
gcctttgccgacatgatgaacaagaccgccggcgacctgggcatgagcaacagccacttc
atgaacccgaccggcctgccgaaccccgagcactattcctcggcgcacgacatggcggta
ctggctcgcgcgatcattcatgaagacccggcccactacgcgatctactcgcagaaagag
ttcttctggaacggcatcaagcagcctaaccgcaacctgttgctgtggcgcgacaagacc
gttgacggcctgaagaccggccataccgacgaagccggctactgcatggtgtcctcggcc
gtgcgtgacggcatgcgcctgatcgccgtggtgttcggcaccaacagcgagcaggcccgc
gccgccgagacccagaagctgctgacctacggtttccgcttcttcgaaacccagaccttc
taccagaaaggcaccgagctggctcaggcacctgtctggaaaggcactacctcccaggtc
aaggccggtctggccgaagacctgaccatgaccatgcccaagggccagctgaagaaactg
gctgccagcatgaccatgaatccacaactggtcgcgcctatcgccaagggcgacgtgatc
ggcaaggtcgaagtgaagctggacgacaaggtggtgcatagcgccgatctgatcgctctg
gacgcggtcgacgaaggtggtatcttccgccgcatgtgggatagcatccgtctattcttc
tacggcttgttcaactga

DBGET integrated database retrieval system