KEGG   Pseudoalteromonas sp. NC201: PNC201_02950Help
Entry
PNC201_02950      CDS       T05464                                 

Gene name
ddc1
Definition
(GenBank) L-2,4-diaminobutyrate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00250  Alanine, aspartate and glutamate metabolism
psen00410  beta-Alanine metabolism
psen00430  Taurine and hypotaurine metabolism
psen00650  Butanoate metabolism
psen01100  Metabolic pathways
psen01110  Biosynthesis of secondary metabolites
psen01120  Microbial metabolism in diverse environments
psen02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PNC201_02950 (ddc1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PNC201_02950 (ddc1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PNC201_02950 (ddc1)
   00430 Taurine and hypotaurine metabolism
    PNC201_02950 (ddc1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PNC201_02950 (ddc1)
Enzymes [BR:psen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PNC201_02950 (ddc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUJ68926
UniProt: A0A2K9JUD6
LinkDB All DBs
Position
688544..690172
Genome map
AA seq 542 aa AA seqDB search
MGPKRCAVASEESLMRIFTVPEAPDSTLSRIEQEISSNLAGFLNENIAAVEKPLHEVEKD
FQSAVIPEVPMFVSDYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFVLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLVYGSDDAFYDKWMHSAKTSLGAFCSGGTIANITAL
WIARNRLLKADGEFKGIGASGIVAAMLHYGYRGLAVLVSERGHYSLGKAADVLGIGRDNF
ISIKTAGNNKVDVDAMRAKANELEAQGIKVLALVGVAGTTETGNIDPLEEMADLAEELNC
HFHVDAAWGGATLLSNNNRYLLKGVERADSITIDAHKQMYVPMGAGMVLFKDPAASDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRQGYEMLIDKGIEKARYFAELI
KQTPDFELISEPELCLLTYRYVPEQIKAAIAQADEQEKIEIYAALNRFTASMQKRQREAG
RSFVSRTRLTPEQYDRQPTVVFRVVLANPLTSESLLKEIMDEQRQLAMSDPVFKKYLAKY
IK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaaagcgttgcgccgttgcgtctgaagaaagcttaatgcgtatatttaccgtg
cctgaggcgcctgattcaactttaagcagaatcgagcaagaaatctcgagcaatttggct
ggctttttaaatgagaatattgcggcagttgaaaagccactgcacgaagttgaaaaagac
tttcagtcggcggtgatccccgaagtgccgatgtttgtctccgactatgcgcaagatatc
atggagcaattagttgcccactcagtgcataccgcagccccaagctttatcgggcatatg
acctcagctttaccgcattttgtgttgccactgtcgaagttgatggtgggactcaatcag
aacctagtcaaaattgaaacgtcaaaagcctttactccgcttgaacgtcaagtattggga
atgatgcatcacttggtttacggcagcgatgatgctttctacgataagtggatgcacagc
gcaaaaacgtcactaggtgctttttgttcgggtggcacaattgcgaatataaccgcgctt
tggattgcaagaaaccgcttattaaaagcggatggtgaatttaaaggtattggtgcatcg
ggtattgtggctgcaatgctacattatggttaccgaggcttagcggtattggtttctgaa
agaggccattattcgttgggtaaggccgcagatgtgctaggtattggccgcgataacttc
atttcaatcaaaacggctggcaacaataaggttgatgttgacgccatgcgagccaaagct
aatgagcttgaagcgcaagggataaaagtactggctttggttggtgttgctgggacgacc
gaaacgggtaatattgaccctctagaagagatggctgatttagctgaagaactcaattgc
cactttcatgtcgacgccgcttggggtggggcaacactactatcgaataacaatcgctac
cttctgaaaggggtggagcgagcagattcaataaccatagatgcgcacaagcaaatgtac
gtgcctatgggagcgggtatggtgttatttaaagacccagcggcatctgatgcaattgaa
catcacgccgaatacatattacggaaaggctctaaagatctgggaagtcatactttagag
gggagtcgtcctggtatggcgatgttagtgcacgcatgtctgcgtgtcattggtcgtcaa
ggctatgagatgcttattgataaagggattgaaaaggcgcggtattttgctgaactaatt
aaacaaacccctgattttgagctgatctctgaacctgagctatgtttgctgacttaccgc
tatgtgcctgagcaaataaaagcggcaatcgcacaagcggatgagcaagaaaagatagag
atttatgctgcacttaaccgttttactgcgagtatgcaaaagcgtcagcgtgaagcgggc
cgctcttttgtttctcgaacacgtttaacaccagagcaatatgaccgccaacccacggtg
gtatttcgagtggttttggccaaccctctgacatcagagtctttgcttaaagaaatcatg
gatgagcaacgccaattggcaatgtcagatccggtatttaaaaaatacctcgcaaaatat
attaaataa

DBGET integrated database retrieval system