KEGG   Pseudoalteromonas sp. NC201: PNC201_06355Help
Entry
PNC201_06355      CDS       T05464                                 

Gene name
sodB1
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psen  Pseudoalteromonas sp. NC201
Brite
Enzymes [BR:psen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PNC201_06355 (sodB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUJ69583
UniProt: A0A2K9JWW4
LinkDB All DBs
Position
complement(1549903..1550484)
Genome map
AA seq 193 aa AA seqDB search
MAFELPSLPYALNALEPHVSQETLEFHHGKHHNTYVVKLNGLIEGTDFEGKSLEEIVCSS
EGGVFNNAAQIWNHTFYWHSLAPNAGGEPTGKVAELINAKWGSFAAFQEAFNDKAVNNFG
SSWTWLVQLADGSLDIVNTSNAATPLTEEGVTPIITVDLWEHAYYIDYRNVRPDYLKGFW
ALVNWDFANSNLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccgtcactaccttatgcactaaatgctcttgagccgcacgtttct
caagagacgctagaattccaccacggtaagcaccacaacacatacgttgtaaagcttaac
ggtcttatcgaaggtactgactttgaaggtaaatcactagaagagatcgtatgtagctct
gaaggtggtgttttcaacaatgctgctcaaatctggaaccacactttctactggcacagc
cttgcgccaaatgcaggtggcgaaccaacaggtaaagttgctgaactaattaatgcaaaa
tggggctcattcgcagcattccaagaagctttcaacgacaaagcagttaacaactttggt
tcaagctggacttggttagtacaactagctgacggttctctagatatcgttaacacttca
aatgcagcaacgccgctgactgaagaaggtgttacacctatcatcacagttgacctgtgg
gaacacgcttactacatcgattaccgtaatgttcgtcctgattaccttaaaggtttctgg
gcacttgttaactgggatttcgcaaacagcaacctagcttaa

DBGET integrated database retrieval system