KEGG   Pseudoalteromonas sp. NC201: PNC201_07035Help
Entry
PNC201_07035      CDS       T05464                                 

Gene name
cga
Definition
(GenBank) Glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00500  Starch and sucrose metabolism
psen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PNC201_07035 (cga)
Enzymes [BR:psen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PNC201_07035 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 TPR_6
Motif
Other DBs
NCBI-ProteinID: AUJ69705
UniProt: A0A2K9JW64
LinkDB All DBs
Position
1704234..1706630
Genome map
AA seq 798 aa AA seqDB search
MIKLSTIALALVSAGLMGCGSQQSGNETLTAPGAPGVKPYWSYSGKTGIGTSYEAYQDGK
YSDSTATKAVSKVWFSVAKGMITETMFGLIHQAQIKDMQFIIVGDGFAVKESDTDALDVT
IDYLYKDASGRPLSLAYKILSKDKQGRFTLEKHIFTDPDGQTLFVRAKVDTEFKNVQAVV
NVNPYVNNNGLNDFAKVTEQGLLAWEGKNYLSLQSKTGFVEASVGFTGTSDNLAALETTG
HIALAYASTGKESGNVNWLANLGQVKGSSTFDLTLSFGHSQQQSFAEGAATLAKGYDKVL
ADYNGQGTAMGWQDYLESLAPLESMTANTADNGKLLYTSALVLKAQEDKTHAGALIASLS
NPWGDTVPAEQGHTGYKAVWVRDFYQVAMAFLAMGDTQTALTAFEYLEKVQVTDKTPGNH
GDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLWQAGVLSDDRLVYWYNKMLKPAAN
FLVEGGLAKILWNDTQIIPPATQQERWEEQNGYSPSTTAAIIAGLVTASDIAKLAGDKAG
QEKFLATAQQYNRDVESFMFTTKGNLQSKHSDGQYFFRIGQDENPNSSTTLNANNGRSGM
DKKQIIDGGFLELVRYGVRGADAPSIVATMPEYDDESIAENLRVKYSFKFDGDVNSYPGY
RRYGNDGYGEDEKRGINYAENGQNTDGQRGRVWPFFTGERGHYDIALALLDGELSADEQS
KIQNTYVKGMEHFANEGMMLPEQVWDGVGKNTFGYQLGEGTNSATPLAWTHAEYVKLVRS
LNEKQVWDHYPIVESKLK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactatcaacaatcgcacttgccttggtaagtgctggcctcatgggttgcgga
tcacagcaatctggcaatgaaaccctgacggcaccaggtgcacctggcgttaaaccttat
tggtcatactctggaaaaacggggattggtacgtcgtacgaagcgtaccaagacggcaag
tacagcgattctacggctactaaagcagtttcaaaggtatggttttctgttgcaaaaggg
atgatcacagagaccatgtttggacttattcaccaagcgcagatcaaagacatgcaattt
atcatcgtgggtgacggctttgcagtgaaagaatctgatactgacgctctagatgtcacg
attgactacctttataaagatgccagtgggcgcccgttatcgctggcttacaaaatatta
agcaaggataagcaaggccgttttactcttgaaaagcatatttttaccgaccctgatgga
caaaccttgtttgttcgagcaaaagtagatactgaattcaaaaatgtacaggctgttgtg
aacgttaatccatacgtgaataacaatggcttaaacgattttgcaaaagtgacagagcaa
ggtttgttagcatgggaaggtaagaactatctctcattgcagagcaaaaccggctttgtt
gaagcatctgtcggttttactggcaccagcgataatttagcggcacttgagactacagga
catatagctctggcttatgcatctacaggcaaagagagtggcaacgttaactggttggca
aacttaggacaagtaaagggcagcagcacctttgaccttaccttgagttttggtcattct
cagcagcaaagctttgctgagggggcagccacattagccaaaggttacgataaagtactg
gctgattataatggtcaaggcactgcgatgggctggcaagattatctcgaaagtttagcg
ccactagagtccatgacggcaaataccgcagacaacggcaagttactttacaccagtgcg
cttgtgcttaaggcgcaagaagataaaacccatgccggtgcactgatagcatcgttgtcg
aatccgtggggtgacacagtaccagcagaacaaggccataccggttataaagcagtatgg
gtgcgtgatttttatcaagtagcgatggcatttttggcgatgggagatacacaaacagca
ctcactgcttttgagtatctagaaaaagtgcaagttacggataaaacaccgggtaaccat
ggtgataccggctggttcttacaaaaaacgcatgtagatggcgagcttgagtgggttgga
gtacagcttgaccaaacagcaatgccgattatgctggcatggaaactgtggcaagcgggt
gtgctaagcgatgatagactggtttattggtacaataagatgttaaagcccgcggctaac
tttttagttgaaggagggctggctaaaatattgtggaatgacacgcaaatcataccgcct
gcgacgcaacaagagcgttgggaagagcaaaatggctattcaccatcgactaccgcggca
atcattgcaggccttgtgacggcgagcgacattgctaaattggccggtgataaagcggga
caagagaaattccttgcgacggcgcagcagtacaatcgtgatgttgagtcattcatgttc
acaaccaaaggtaatctgcaaagcaaacacagtgacggtcaatattttttccgtattgga
caagacgaaaaccctaattccagtacgaccttaaatgccaataatggccgcagcggaatg
gataagaagcaaatcatcgacggtggctttttagaacttgtgcgttacggggttagaggg
gctgatgccccaagcatcgtggctaccatgcctgaatatgatgatgagtcgatagctgaa
aacttaagagtaaaatatagctttaaatttgatggcgatgttaatagttatccggggtat
cgccgttacggtaacgacggttatggtgaagacgagaagcgcggtattaattatgccgaa
aatggtcagaataccgatggccaacgcggtcgagtgtggcctttctttaccggagagcgt
ggtcactatgatattgcgctggcgctgctcgatggtgagttaagtgcggatgaacagagc
aaaatacaaaatacctacgtgaaggggatggagcactttgctaatgaaggcatgatgtta
cctgagcaagtatgggatggtgtgggtaaaaatacctttggctatcaacttggcgaagga
accaactcagcgacgcctttggcttggacacatgctgaatacgtaaagttagtgcgctct
cttaatgaaaaacaagtgtgggatcactacccaatcgtagaaagtaaactgaaataa

DBGET integrated database retrieval system