KEGG   Pseudoalteromonas sp. NC201: PNC201_09645Help
Entry
PNC201_09645      CDS       T05464                                 

Definition
(GenBank) Angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
psen  Pseudoalteromonas sp. NC201
Brite
KEGG Orthology (KO) [BR:psen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:psen01002]
    PNC201_09645
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psen04147]
    PNC201_09645
   04090 CD molecules [BR:psen04090]
    PNC201_09645
Enzymes [BR:psen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PNC201_09645
Peptidases [BR:psen01002]
 Metallo Peptidases
  Family M2
   PNC201_09645
Exosome [BR:psen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PNC201_09645
CD molecules [BR:psen04090]
 Proteins
  PNC201_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Reprolysin_5
Motif
Other DBs
NCBI-ProteinID: AUJ70222
UniProt: A0A2K9JY26
LinkDB All DBs
Position
2312491..2314311
Genome map
AA seq 606 aa AA seqDB search
MKPRFKLSVGALIVASTFALSACKSTETTNKALSEADAVAFLDKASEQLVDLNFRSSRSA
WIYANFITHDTASFAADVNEEYTAALVELANQAAQFDGSTLNEDTRRKLDKLKLNLTLPA
PKDADKTAELAKLTAELDGMYGKGKYCKDDGTCLSLGDMTAKMANSRDYEELLDIWQGWR
EVSKPMRPLYEKQVVLTNEGANELGYADTGAMWRSKYDMPADDFAKELDRTWNQVKPLYD
SLHCHVRAKLGEKYGEDKVPQDQPIPAHLLGNMWAQSWGNIYDLVAPENADPGYDVTALL
AKHNYDEIKMVKGAEKFFTSMGFAPLPETFYERSLFIKPQDRDVQCHASAWNLDAKDDLR
IKMCIQRTGEEFSVIHHELGHNFYQRAYNQQPVYYQESANDGFHEAIGDTIALSVTPGYL
KQIGLLDNVPDESKDIGLLMKMALDKVAFIPFGLLVDQWRWKVFSGEISPAEYNQAWWEL
REKYQGVKAPISRTENDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKSLCEIAGSKEAIH
RCSVYNSKAAGERLNAMLEMGSSKPWQQALKTLTGKDEMDATAVLDYFAPLQKYLDEQNK
GRNCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaagatttaagttaagtgttggcgcactcattgttgccagtacttttgcactc
tctgcctgcaaatccactgaaactacaaataaagcgttatcagaagccgatgcagtagca
tttttagataaggcgtcagaacagttggttgaccttaacttccgctctagccgctcagct
tggatttacgcgaactttattactcacgataccgcttcatttgctgcggacgttaatgag
gaatacaccgctgcgctcgtggagcttgctaaccaagctgcacaatttgatggctcgacg
ttaaacgaagatactcgccgcaagcttgacaaattgaagctaaacctgacattacctgca
ccaaaagatgctgacaaaacagcggaacttgcaaagctcactgcagagcttgatggtatg
tacggcaagggcaaatactgtaaagatgatggcacttgcctaagccttggcgacatgacg
gctaagatggcgaatagtcgcgactatgaagagcttttagacatctggcaaggttggcga
gaagtgtcaaagccgatgcgtccactctatgaaaagcaagtggtacttaccaatgaaggt
gctaatgagcttggctacgcagacacaggcgccatgtggcgcagtaagtacgacatgcca
gcggacgactttgcaaaagaacttgaccgtacttggaaccaagtaaagccgctatatgat
tcgctgcactgtcatgttagagccaagcttggcgagaaatacggcgaagataaagtgcct
caagaccagcctattcctgcacacttgcttggcaatatgtgggcacaaagctggggcaat
atctatgacttagtcgcgccagaaaacgcagatccgggttatgatgtaacggcgctactg
gctaaacacaattacgacgaaatcaaaatggtaaaaggtgcagaaaagttcttcacctct
atgggttttgccccattacctgagactttctacgaacgttctttatttattaaaccacaa
gaccgcgacgtacaatgtcatgcatcagcatggaacttagatgccaaagacgacctacgc
atcaaaatgtgtatccaacgcaccggtgaagagttctcagttatccaccatgaactaggc
cataacttctatcagcgcgcttacaatcaacagcctgtgtattaccaagaaagtgccaac
gatggcttccacgaagctatcggcgacaccatcgcgctatctgtaacacctggctactta
aagcaaattggtttgttggataacgtaccggatgagtcaaaagatatcggtctattgatg
aagatggcactcgacaaagttgcatttattccattcggtctacttgtcgaccaatggcgc
tggaaagtattctctggtgagatttctccagcagagtacaaccaagcgtggtgggaatta
agagagaaatatcaaggtgttaaagcaccaatttcacgtacagaaaatgactttgaccca
ggtgcaaaataccacgtacctggtaatgtgccttacactcgttacttcctagcgcatatt
ttgcagttccaattccacaaatcactttgtgaaattgctggaagcaaagaagccattcac
cgctgttctgtttacaactcgaaagcagctggtgagcgtttaaatgccatgcttgaaatg
ggcagcagcaaaccttggcaacaagcacttaaaacgctaacaggtaaagatgaaatggat
gcaacagcagtacttgactactttgcaccattgcaaaaatacctagatgagcaaaataaa
ggccgtaattgcggctggtaa

DBGET integrated database retrieval system