KEGG   Pseudoalteromonas sp. NC201: PNC201_18055Help
Entry
PNC201_18055      CDS       T05464                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00071  Fatty acid degradation
psen00280  Valine, leucine and isoleucine degradation
psen00281  Geraniol degradation
psen00310  Lysine degradation
psen00362  Benzoate degradation
psen00380  Tryptophan metabolism
psen00410  beta-Alanine metabolism
psen00640  Propanoate metabolism
psen00650  Butanoate metabolism
psen00903  Limonene and pinene degradation
psen00930  Caprolactam degradation
psen01100  Metabolic pathways
psen01110  Biosynthesis of secondary metabolites
psen01120  Microbial metabolism in diverse environments
psen01130  Biosynthesis of antibiotics
psen01200  Carbon metabolism
psen01212  Fatty acid metabolism
Module
psen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PNC201_18055 (fadJ)
   00650 Butanoate metabolism
    PNC201_18055 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PNC201_18055 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PNC201_18055 (fadJ)
   00310 Lysine degradation
    PNC201_18055 (fadJ)
   00380 Tryptophan metabolism
    PNC201_18055 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PNC201_18055 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PNC201_18055 (fadJ)
   00281 Geraniol degradation
    PNC201_18055 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PNC201_18055 (fadJ)
   00930 Caprolactam degradation
    PNC201_18055 (fadJ)
Enzymes [BR:psen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PNC201_18055 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PNC201_18055 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PNC201_18055 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AUJ71828
UniProt: A0A2K9K2M0
LinkDB All DBs
Position
pNC201:30930..33032
Genome map
AA seq 700 aa AA seqDB search
MSVFSYELNDHKVAIVTIDVPGEKMNTLRDTFADELLEIIAKSKQDDVTGMVFISGKDDN
FIAGADIKMLDSAKTREDALAISEMCHKTFFKLADLPFPTVAAIHGVALGGGLEFALACD
YRVCTEDSKTKLGLPEVQLGLLPGGGGTQRLPKLVGIQKALEWMLTGKQVRPKQAKKAGL
VDDSVPHSILLDVAVKLARKGKPKPRKPNLDKISQLLESNPFGRNIIFKKAQENVEKKTG
GHYPAPSAIIKAVRASVELDKLKGYKTEAEGFADLVMSEVSRSLRGIFFATTEMKKDFQG
EDLAPVKRVAVLGGGLMGAGITHVSAVKAGTPVRIKDVAHQGISNALNYSYKILTQRQKR
RIISKAEMQSTLNMITGTTDYSGFKHTDMVIEAVFEDLDLKQSMVADIERECSESTIFAS
NTSSLPIGQIAAKATRPENVIGLHYFSPVEKMPLVEIIPHDTTSDEVIARTVAFARKQGK
TPIVVKDKAGFYVNRILAPYVNEAANLLLAGEPIEKIDQALVEFGFPVGPLALLDEVGVD
IGSKIAPILEKELGARFKAPDAFARMIDSKRLGRKSGRGFYTYEGKKGKQVDESVYELLG
VTPSPKLNKQEIANRCVAQMLNEAARCLDEGIIRNARDGDIGAIFGIGFPPFLGGPFSYM
DKKGANKVCSELSTYAADNPVFTPAEPLLAMAEEGKAYYE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtattttcttatgaattaaacgaccataaagtcgccatcgtcaccatcgacgtg
ccgggcgaaaaaatgaacaccctacgtgatacatttgctgatgaattattagagatcatc
gcaaagagtaagcaagacgacgtaacgggtatggtttttatcagtggtaaagacgataat
tttatcgctggtgcagacattaaaatgctagacagcgcgaaaacccgtgaagatgcgtta
gcgatttcggaaatgtgtcataaaaccttttttaaattggctgatttaccattcccaacc
gttgccgcgatccacggtgtagcactggggggcggcttggagtttgcgctggcttgtgat
taccgtgtttgtaccgaagacagcaagactaaactgggtcttcctgaagtacagcttggt
ctattgccaggtggtggcggtacacagcgtctaccaaaattagttggtattcaaaaagca
cttgaatggatgctaactggtaaacaagttcgacctaagcaagcgaaaaaagcgggccta
gttgacgattccgtgccgcacagtattttactcgacgtagcggtgaagcttgcgagaaaa
ggtaagcctaagcctcgcaaaccgaatttagacaaaattagccaattgctagagtctaac
ccgttcggacgcaatatcattttcaaaaaagcacaagaaaatgttgagaagaaaacgggt
ggtcactatccagcgccgtccgctatcatcaaagcggtacgtgcatctgtagagctggac
aagcttaaaggttataaaaccgaagccgagggttttgctgatttagtgatgtctgaagta
tcccgctcgctacgtgggattttctttgcgacaacggaaatgaaaaaggatttccaaggt
gaagatcttgctcctgtgaagcgtgttgcagtgctaggtggtggcttaatgggcgcaggt
attacccatgttagtgcggttaaagcaggcactccagtacgtattaaagatgttgcgcat
cagggcattagcaacgcattaaattacagctataagatcctaacgcaacgccaaaagcgt
cgtattatttcaaaggcagagatgcagtcaactttgaatatgatcacggggacaacagat
tactctggttttaaacacacagacatggtgattgaagctgtatttgaagacttagacctt
aaacagtcgatggtagcggatattgaacgcgaatgcagtgagagtacaatatttgcaagt
aatacgtcatcattaccaatcggccaaatcgcggcaaaagcaacgcgtcctgaaaacgta
attggtttgcattatttctcgccagtagaaaaaatgccgctggtggagatcattccgcac
gataccaccagtgatgaggttattgcgcgcactgtggcgtttgctcgcaagcaggggaaa
accccaatcgtagtaaaagacaaagctggtttttacgtaaaccgtattctggctccttat
gtcaacgaagcggcaaatcttttgcttgccggtgagccgatagagaaaatcgatcaagcc
ttggttgagtttggtttccctgttggtcctcttgcgcttcttgatgaagtaggtgtagac
attggctctaagattgcgccaatcctagaaaaagaattaggtgctcgctttaaggcgccg
gatgcttttgcacgtatgatagatagcaaacgtcttggtcgcaaatctggtcgtggtttc
tacacctatgaaggtaaaaaaggcaagcaagtggacgagtcagtttatgagttactcggt
gtcacgccttctcctaaattgaataaacaagaaattgcgaaccgctgcgttgcgcagatg
ctcaatgaggctgctcgctgtcttgatgaaggtattattcgtaatgcaagagatggtgat
atcggtgctatttttggcattggtttcccaccattcttgggcggcccatttagttatatg
gacaaaaaaggcgccaataaggtgtgttcagagctatcaacatacgctgctgacaaccct
gtatttacacctgcggagccgctactcgcaatggccgaagaaggcaaagcttattacgag
taa

DBGET integrated database retrieval system